KEGG   Equus caballus (horse): 100054704
Entry
100054704         CDS       T01058                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb00240  Pyrimidine metabolism
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100054704 (DCK)
   00240 Pyrimidine metabolism
    100054704 (DCK)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100054704 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_28 AAA_18 AAA_33 AAA_17 DUF932
Other DBs
NCBI-GeneID: 100054704
NCBI-ProteinID: XP_001489275
Ensembl: ENSECAG00000021782
VGNC: 17040
UniProt: F6X3X8
Position
3
AA seq 263 aa
MATPPKKSCLSPTTGPQRTRIKKVSIEGNIAAGKSTFVNILKQVCEDWEVVPEPVTRWCN
VQSTQDEFEELTTVEKTGGNVLQMMYEKPERWSFTFQLYACLSRIRAQFASLNGKLKNAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNKQMGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQDIPLEYLEKLHSKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKYDSLVEKVKEFLNTLSSC
NT seq 792 nt   +upstreamnt  +downstreamnt
atggccaccccacccaagaagagctgcttgtctcccacgaccggccctcagaggacccgc
atcaagaaagtctccatcgaagggaacatcgctgcagggaagtcaacttttgtgaatatt
cttaaacaagtctgtgaggattgggaagtggttcctgagcctgttaccagatggtgcaat
gttcaaagtactcaagatgaatttgaggaattgacaacagttgagaaaactggcgggaat
gttctgcagatgatgtatgagaaacccgaacgatggtcttttaccttccagttatatgcc
tgcctcagtcgaatacgagctcagtttgcctctctcaatggcaagctcaaaaatgcggag
aaacctgtattattttttgagcgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaataaacagatgggccaaagccttgaactggatggaatcatttatcttcgagct
actccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaagatatt
cctcttgaatatttagagaagcttcactctaagcatgaaagctggctcctgcatagaaca
ctgaagaccaattttgattatctacaagaagtgcctattttaacactggatgttaatgaa
gactttaaagacaaatatgacagtctggttgaaaaggtcaaagaatttctgaacactttg
tcatcttgctga

DBGET integrated database retrieval system