KEGG   Equus caballus (horse): 100055006Help
Entry
100055006         CDS       T01058                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    100055006 (MAPK6)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100055006 (MAPK6)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100055006 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 100055006
NCBI-ProteinID: XP_001501498
Ensembl: ENSECAG00000008209
VGNC: 19960
UniProt: F6VA95
Position
1
AA seq 722 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS
TEPCWQYPDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLADKEREKGQGFDFDSFIAGTIQLSAQ
HEPADVVDKLNDLNSSVSQLELKSLISKSVSREKQEKGMANLAQLEALYQSSWDSQFVGS
GEDCFLINQFCCEVRKDEQIEKENTYTSYLDKFFSRKEDTEMLETEPGEDGKLGERENEE
GFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKH
LN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggctctaggtat
atggacttaaaaccattgggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaagagagtagccatcaagaaaattgtccttactgatccccagagtgtcaaa
catgctctacgtgaaatcaaaattattagaagacttgaccatgataacattgtgaaagtg
tttgaaattcttggtcccagcggaagccagttaacagatgatgtgggctctcttaccgaa
ctgaacagtgtttacattgttcaggagtacatggagacagacttggctaatgtgctggag
cagggccctttactggaagagcatgccaggcttttcatgtatcagctgctacgtgggctc
aaatatattcactctgcaaacgtactgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgactttggtcttgcacggatcatggatccc
cattattcccataagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgtcttttactttctcctaataattatactaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaaccctctttgcaggtgcacatgaacttgaacag
atgcagctgattttagaatctattcctgttgtacatgaggaagatcgtcaggagcttctc
agtgtaattccagtttacattagaaatgacatgactgagccacacaaacctttaactcag
ctgcttccgggaattagtcgagaagcactggatttcctggaacaaattttgacatttagc
cccatggatcggttgacagcagaagaagcgctttcccatccttatatgagcatatattct
tttccaatggatgagccaatttcaagtcatccttttcatattgaagatgaagttgatgat
attttgcttatggatgaaactcacagtcacatttataactgggaaaggtaccatgattgt
caattttcagagcatgattggcctatacataacaactttgatattgatgaagttcagctt
gacccaagagctctgtctgatgtcactgatgaagaagaagtacaagttgatcctcgaaaa
tatttggatggagatcgtgaaaagtatttggaggatcctgcttttgataccaattactct
actgagccttgctggcagtacccagatcatcatgaaaacaaatattgtgatctggagtgt
agccatacttgtaactacaaaacgaggtcatcatcatatttagataacttagtttggaga
gagagtgaagttaaccattactatgaacccaagcttattatagatctttccaattggaaa
gaacaaagcaaagaaaaatctgataagaaaggcaagtcaaaatgtgaaaggaatggattg
gttaaagcgcagatagctctagaggaagcatcccagcaactggctgacaaagaaagggaa
aagggtcaggggtttgactttgactcctttattgcaggaactattcaactgagcgcacag
catgagcctgctgatgttgttgataaattaaatgacttgaatagctcagtgtcccaacta
gaattgaaaagtttgatatcaaagtcagtaagccgagagaaacaggagaaaggaatggcc
aatttggctcagttagaagccttgtaccagtcttcctgggatagccagtttgtgggcagt
ggggaggactgttttctcataaatcagttttgttgtgaggtgaggaaggatgaacagatt
gagaaggaaaacacttacaccagttacttggacaagttctttagcaggaaagaagatact
gaaatgctagaaactgagccaggagaggatgggaagcttggggagagagaaaatgaggaa
ggatttctgaacaacagtggggagttcctctttaacaagcagcttgaatccataggcatc
ccacagtttcacagtcccgttgggtcaccacttaagtcaatccaggctacattaacacct
tctgctatgaaatcttcccctcagattcctcataaaacatacagcagcattctgaaacac
ctgaactaa

DBGET integrated database retrieval system