KEGG   Equus caballus (horse): 100055368Help
Entry
100055368         CDS       T01058                                 

Gene name
ZDHHC20
Definition
(RefSeq) probable palmitoyltransferase ZDHHC20 isoform X1
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100055368 (ZDHHC20)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     100055368 (ZDHHC20)
Membrane trafficking [BR:ecb04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    100055368 (ZDHHC20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC RecR Spt4
Motif
Other DBs
NCBI-GeneID: 100055368
NCBI-ProteinID: XP_023477141
Ensembl: ENSECAG00000016465
VGNC: 25195
Position
17
AA seq 430 aa AA seqDB search
MAPWTFWRCCQRTVGWVPVLFIAFVVAWSYYAYVVELCVVTLSGNGENGKAVVYLVGFHL
FFVMFVWSYWMTVFTSPASPSKERCILSGKNFLTSYSFLKREWAVLQSRKVFLYLQVFER
GWISEMSADSCLPGGLDKWPLKTRLKFYLSSSDKERYEKEFNQERQQEILRRTARDLPIS
TLSAARTIRYCERCQLIKPDRAHHCSACDICVLKMDHHCPWVNNCVGFSNYKFFLLFLLY
SLLYCLFVATTVLQCFIKFWTLCRRKSTESCAKNELSATRAKFHVLFLFFVSTMFFISVL
SLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSS
LGDGCSFPTRLVGMDPEQASVSNQNEYARSIGSNQPFPVKPLSESKNRLLDSESQWLENG
SEESTVRSGL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtggacgttctggcgctgctgccagcgcacggtgggctgggtgccggtgctc
ttcatcgccttcgtggtcgcctggtcctactacgcgtacgtggtggagctgtgcgtggtt
actctttctggaaatggagaaaacggaaaggccgttgtttaccttgtgggtttccatctg
ttctttgttatgtttgtatggtcctattggatgacagttttcacatctcccgcttccccc
tccaaagagagatgcatcctgtcagggaagaactttctgacaagttacagttttcttaaa
agagaatgggccgtcttgcaaagtaggaaagtatttctatacctgcaagtattcgagagg
ggttggatctcagaaatgtcggcagattcctgcttgcctggagggttagataagtggccc
ctgaagactcgacttaagttctacttgtccagttctgacaaggaacgttatgaaaaggaa
ttcaaccaagaaagacaacaagaaattttgagaagaacggcaagggacttacctatctcc
accctgtcagctgcaaggaccatcagatattgtgaaagatgtcagttgattaaacctgac
cgtgcgcatcactgctcagcatgtgacatatgtgttcttaagatggatcatcactgtcct
tgggtgaataactgtgtgggattttctaattataaattcttcctgctgtttttattgtat
tccctattatattgccttttcgtggctacaacagttttacagtgctttataaaattttgg
acgctttgccgcaggaaatctacagagagttgtgcaaagaatgaactctcagctacacgt
gcaaaattccacgtgctttttcttttctttgtgtctacaatgttcttcatcagcgtcctg
tcgctgttcagctaccactgctggctagttgggaaaaatagaacaacgatagaatcattc
cgtgcacccacattttcctatggacctgatggaaatggtttctctcttggatgcagtaaa
aattggagacaagtctttggtgatgaaaagaaatattggctacttccaatattttcaagt
ttgggtgatggttgcagtttcccaactcgcctggtggggatggatccagagcaagcttct
gtttcaaaccaaaacgaatatgccagaagtattggctcaaatcaaccctttcctgtcaaa
ccacttagtgaatcaaaaaaccggttattggacagtgagtctcagtggctagagaatgga
tctgaagaaagcaccgtcagatcaggtttataa

DBGET integrated database retrieval system