KEGG   Equus caballus (horse): 100055763
Entry
100055763         CDS       T01058                                 

Gene name
TMEM168
Definition
(RefSeq) transmembrane protein 168
Organism
ecb  Equus caballus (horse)
SSDB
Motif
Pfam: Tweety
Other DBs
NCBI-GeneID: 100055763
NCBI-ProteinID: XP_005609376
Ensembl: ENSECAG00000021172
VGNC: 24217
UniProt: F6VHJ9
Position
4
AA seq 697 aa
MCKSLRYCFSHCLYLAMTRLEEVNREVNMHSSVRYLGYLARFNLLVAICLGLYVRWEKTA
NSLILVIFILGLFVLGIASILYYYFSMEAASLSLSNLWFGFLLGLLCFLDNSSFKSDVKE
ESTKYLLLTSIVLRILCALVERISGYVCHRPTLLTTVEFLELVGFAIASTTMLVEKSLSV
ILLVVALAMLIIDLRMKSFLAILNLVIFAVLLFFSSLETPKNPVAFACFFICLITDPFLD
IYFSGLSVTERWKPFLYRGRICRRFSVVFTGMIELTFFILSAFKLRDTHLWYFVIPGFSI
FGIFWMICHIIFLLTLWGFHTKLNDCHKVYFTHRVDNNSLDRIMASKGMRHFCLISEQLV
FFSLLATAILGAVSWQPTNGIFLSMFLIVLPLESMAHGLFHELGNCLGGTSVGYAIVIPT
NFCSPDGQPTLLPPEHVQELNLRSTGMLNAIQRFFAYHMIETYGCDYSTSGLSFDTLHSK
LKAFLELRTVDGPRHDTYVLYYSGHTHGTGEWALAGGDILRLDTLLEWWREKNGSFCSRL
IIVLDSENSTPWVKEVRKISDQYIAVQGAEMTKTVDIEEADPPQLGDFTKDWVEYNCNST
NNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAKHWMLHFPRITYPLVHLANWLCGL
NLFWICKTCFRCLKRLKMSWFLPTVLDTGQGFKLVKS
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgtgtaaatcactgcgttattgctttagtcattgtctctacttagcaatgacgagactg
gaagaagtaaacagagaagtgaacatgcattcttcagtgcgttatcttggctatttagcc
aggttcaatttactggttgctatatgcttaggtctttatgtaagatgggaaaaaacagca
aattccttaattttggtaatttttattcttggtctttttgttcttggaattgccagcata
ctctattattatttttcaatggaagcggcaagtttaagtctctccaatctttggtttgga
ttcttgcttggcctcctatgttttcttgataattcctcctttaaaagtgatgtgaaagag
gaatcaaccaaatatttgcttctaacttccatagtgttaaggatattatgcgctttggtg
gagagaatttctggttacgtctgtcatcgacccactttattaaccacagttgaatttctg
gaacttgttggatttgccattgccagcacaactatgttggtggagaagtctctgagtgtc
attttacttgttgtagctttggccatgctgattattgacttgagaatgaagtctttccta
gctattctaaacttagttatttttgcagtcttgttatttttctcctcattggaaactcca
aaaaatccagttgcttttgcatgtttttttatttgcctgataactgatcctttccttgac
atttattttagtggactttcagtgactgaaaggtggaaaccctttttgtaccgtggaaga
atttgcagaagattttcagttgttttcactggaatgatagagcttacattttttattctt
tcagcatttaaacttagagatactcatctctggtattttgtaataccaggcttttccatt
tttggaattttctggatgatttgccatattatttttcttttaactctttggggattccat
accaaattaaacgactgccataaagtatattttacacacagggtagataacaatagcctt
gatagaatcatggcatccaaaggaatgcgtcatttttgcttaatttcagaacagttagtt
ttttttagtcttcttgcaacagcaattttgggagcagtatcctggcagccaacaaatgga
atcttcttgagcatgtttctcattgttttgccattggaatctatggctcatgggctcttc
catgaattgggtaattgtttaggaggaacatctgttggatatgctattgtgattcccacc
aacttttgcagtcctgatggtcagccgacacttcttccgccagaacatgtacaagagtta
aatttgaggtctacgggcatgctcaatgctatccaaagattttttgcatatcatatgatt
gagacctatggatgtgactactccacaagtggactgtcttttgatactctacattccaaa
ctgaaagctttccttgaacttcggactgtggacggacctagacatgatacatatgttttg
tattacagtgggcacacgcatggtacaggagagtgggctcttgcaggtggagacatacta
cgccttgacacacttctagagtggtggagagaaaagaatggttccttctgttcccgactt
attattgtattagatagtgagaattcaaccccttgggtgaaagaagtgagaaaaatcagt
gaccagtatattgcagtacaaggagcagaaatgacaaagacagtagacatcgaagaagct
gacccacctcagctgggggactttacgaaagactgggtagaatataactgcaactccact
aataacatctgctggactgaaaagggacgcaccgtcaaagcagtatatggtgtgtcaaaa
cggtggagtgattacactctgcacttgccaacgggaagcgacgtggccaagcactggatg
ttacactttcctcgtattacatatccactagtgcatttggcaaattggttgtgtggtctg
aaccttttttggatctgcaaaacttgttttaggtgcttgaaaagattaaaaatgagttgg
tttcttcctactgtgctggacacaggacaaggcttcaaacttgtcaaatcttaa

DBGET integrated database retrieval system