KEGG   Equus caballus (horse): 100056040Help
Entry
100056040         CDS       T01058                                 

Gene name
CDC42BPG
Definition
(RefSeq) serine/threonine-protein kinase MRCK gamma isoform X1
  KO
K16307  serine/threonine-protein kinase MRCK [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100056040 (CDC42BPG)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100056040 (CDC42BPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr DMPK_coil C1_1 Kinase-like PH Pkinase_C KELK Haspin_kinase PBD Seadorna_VP7 Dsl1_C
Motif
Other DBs
NCBI-GeneID: 100056040
NCBI-ProteinID: XP_023510137
Position
12
AA seq 1605 aa AA seqDB search
MEQRRRALEELARGEAGGGPGLDGLLDLLLGLHHELSSAPLRRERNVAQFLSWASPFVTK
VKELRLQRDDFEILKVIGRGAFGEVAVVRQRDSGQIFAMKMLHKWEMLKRAETACFREER
DVLVKGDSRWVTALHYAFQDEEYLYLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMV
LAIHSLHQLGYVHRDVKPDNVLLDMNGHIRLADFGSCLRLNNSGMVDSSVAVGTPDYISP
EILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAESLVETYGKIMNHEDHLQFPPD
VPDVPASARDLIRQLLCHQEERLGRRGLDDFRNHPFFEGVDWERLATSTAPYIPELRGPM
DTSNFDVDDDTLNHPGTLPPPSHGTFSGHHLPFVGFTYTSSSPSPESSSEQVAALEQRLR
CLEQEKTELSRKLQEALQMPSDHRELEQLRKEVQTLQDRLSEMLRESKAPVSQTEGSPGQ
HSDLQQERDRLLQELAEAQTRLQMQEQELGRAQGRQEELLQRLQEAQEREASTASQTQAL
NSQLEEARDARRELQAQVATLSREVRRLQRDQERSLEKEPSQVKTVHTTSETNGTGSPES
RPQEAQLRKEVAALRVQLEQARSHGPSGKEEALCRLQEENRRLSQEQERLVEELERELQS
KQRLEGERQESESNWEAQLADILSWVNDEKVSRGYLQALATKMAEELESLRNVGTQTLPT
RPLVSPGDTLGGGGAGSLTPQVGILSSWKISDLPKLTADQWQSWGSEPGQDHQWKARRLQ
KMEASARLELQSALEAEIRAKQSLQERLTQAQEAQLQAESRLQEAEKQNQSLKQELAALR
EELRARGPGDTKPSNSLIPFLSFRSSEKDPAKDPGISGEAPRPGSEPELRPEGRRSLRLG
AVFPRAPAATTAATEGPPAKPGSHTLRPRSFPSPTKCLRCASLMVGLGRQGLGCDACGYF
CHSTCAPQAPPCPVPPDLLHVALGVHPETGTGTAYEGFLSVPRPSGVRRGWQRVFAALSD
SRLLLFDAPDPRLSPASGALLQALDLRDPQFSATPVLASDVIHAQSKDLPRIFRVTASQL
TVPPATCTVLLLAESEGERERWLQVLGELQRLLLDTRPQPRPVYTLKEAYDNGLPLLPHA
LCAAIIGSQQLCEKDQERLALGTEEGLFVIHLHSNDIFQVGECRRVQRLAVSPTAGLLVV
LCGRGPSVRLFALAELESTEVAGAKIPESRGCQVLAAGRILQARTPVLCVAVKRQVLCYQ
LGPGPGPWQHRIRELQAPAPVQSLGLLGDRLCVGAAGAFALYPLLNEAAPLALGADLVPE
ELPPSRGGLGEALGAVELSLNEFLLLFTTAGVYVDGAGRKSRIHELLWPAVPTGWGYAAP
YLTVFSENSIDVFDVRKAEWVQTVPLKKVRPLNPEGSLFLYGTEKVRLTYLRNRLAEKDE
FDIPDLTDNSRRQLFRTKSKRRFFFRVSEEQRQQQRREMLKDPFVRSKLISSPTNFNHLV
HMGPMDGKPSARNPPRAPEEKGRGSRSSGPQRPHSFSEASRRPASMGSDGLAGDADPKVK
RKPWTSLSSESVSCPQGSLSPAASLTQVSERPRSLPPAPEPESSP
NT seq 4818 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcggcggcgcgcgctggaggagctggcacggggcgaggccggcggcggcccg
gggctcgacggcctcctggatctgctgctggggctgcaccacgagctcagcagcgccccc
ctgcggcgggagcgcaacgtggcgcagttcctgagctgggccagccccttcgtcacgaag
gtgaaagagctgcggctgcagagagatgactttgagatcttgaaggtgatcggccgaggg
gccttcggggaggtcgccgtggtgaggcagagggacagcgggcagatttttgccatgaaa
atgctgcacaaatgggagatgctgaagagggccgagacagcctgtttccgggaggagcgg
gacgtgctggtgaagggggacagccgctgggtgactgctctgcattacgccttccaagac
gaggagtacctgtacctcgtgatggactactacgctggtggggacctcctcactctgctg
agccgcttcgaggaccgcctcccgcccgagctggcccagttctacctggctgagatggtg
ctggccatccactcactgcaccagctgggctatgtccacagggatgtcaagccggacaat
gtcctgttggatatgaatggacacatccgcctggctgactttggctcctgcctgcgtctc
aacaacagtggcatggtggattcatcggtggcagtggggacccctgactacatctcccct
gagatcctgcaggccatggaggagggcaagggccactacggcccacaatgcgactggtgg
tcgctgggagtctgcgcctacgagctgctctttggggagacgcccttctatgctgaatcc
ctggtggaaacctacggcaagatcatgaaccatgaggaccacctgcagtttcccccggat
gtgcccgacgtgccggccagcgcgagagacctgatccgccagctgctgtgccaccaggag
gagcgactgggccgcagagggctggacgacttccggaaccaccctttcttcgaaggtgtg
gactgggagcggctggcgaccagcactgccccctacatccctgagctccgtgggcccatg
gacacctccaacttcgacgtggatgatgacaccctcaaccatccagggaccctgccacca
ccctcccatgggaccttctccggccaccacctgccatttgtgggcttcacctacacctcg
agcagtcccagccctgagagcagctccgagcaggtggctgccctggagcagaggctccgt
tgtctggagcaggagaagacggagctgagccggaagctccaagaggccctgcagatgccc
tcggaccaccgggagctggagcagctgcggaaggaggtgcagactctacaggacaggctg
tcagagatgctgagggaaagcaaggcccccgtgtctcagacggagggtagcccaggccag
cacagtgaccttcagcaggagagagaccggctcctccaggagctggccgaggctcagaca
aggctgcagatgcaggagcaggagctgggcagagcccaagggcggcaggaggagctgctc
cagaggctgcaggaagcccaggagagagaggcatccacagccagccagacccaggccctg
aactcccagctggaggaggcccgggatgcccggagggagctgcaggcccaggtggccacc
ctgagccgggaggtgaggcggctccagagagatcaggagcgaagccttgagaaggagcca
tcccaggtcaagaccgtccacaccacctccgagaccaacggcacgggctcgcccgaaagc
aggcctcaagaagcccagctcaggaaggaggtggctgccctgcgtgtgcagctggagcag
gcccgcagccacgggccgagcgggaaggaggaggctctgtgccggctgcaggaggagaac
cggcggctgagccaggagcaggagcggctggtggaagagctggaacgggagctgcagagt
aagcagcggctggagggcgagcggcaggagtcagaaagcaactgggaggcccagctcgcc
gacatcctcagctgggtgaatgatgagaaggtctccagaggctacctacaggccctggcc
accaagatggccgaggagctggagtccctgcggaatgtgggcacccagacgctccccacc
cggccactggtgagccccggagacaccctgggaggagggggtgccggtagcctcactcca
caggtggggatactgagctcgtggaagatcagtgacttgcctaagctcacagcggatcag
tggcagagctggggctctgagcctggccaggaccaccagtggaaggcacggcggctgcag
aagatggaggcctcggccaggctggaactgcagtcggcactggaggccgagatccgggcc
aagcagagcctgcaggagcggctgacgcaggcgcaggaggcccagctgcaggccgagagc
cgtctgcaggaggccgagaagcagaaccagagcctgaagcaggagctggctgcacttcgg
gaggagctgcgagcccgcgggccaggagacaccaagccctcaaactcgctgattcccttc
ctgtccttccggagttcagagaaggatcccgccaaggaccctggcatctcaggagaggcc
ccgaggccggggtcggaaccggagctgaggccggagggccgccgcagcctgcgcctgggg
gctgtgttccccagagcacctgctgccaccacagctgctacagaaggccctcccgcaaag
cctggctcccacacgctgcgcccccggagcttcccgtcccccaccaagtgtctccgctgc
gcctcgctgatggtgggcctgggccgccaaggcctgggctgtgatgcctgcggctacttc
tgtcactcaacttgtgccccacaggccccaccctgccccgtgccccctgaccttctccac
gtggccctgggagtgcaccccgaaacgggcacgggcactgcctatgagggcttcctgtcg
gtgcctcgaccctcgggtgtccggcggggctggcagcgggtgttcgctgccctcagtgac
tcacgcctgctgctgtttgacgccccggacccgcggctcagcccagccagcggggccctc
ctgcaggcactggatctgagggacccccagttctctgccacccctgtcctggcctctgat
gtgatccatgcccaatccaaggacctgccacgcatctttagggtgacggcgtcccagctg
acggtgccacctgccacgtgcaccgtgctgctgctggcggagagcgagggcgagcgggag
cgctggctgcaggtgctgggcgagctgcagcggctgctgctggacacgcggccacagccc
cggcctgtgtacacgctcaaggaggcctacgacaatgggctgcccctgctgccgcacgcg
ctctgcgccgccatcatcggctcacagcagctctgtgagaaagaccaggaacggcttgct
ctgggcactgaggaagggctgtttgtgatccacctgcacagcaacgacatcttccaggtg
ggcgagtgccggcgggtgcagcggctggccgtgagccccactgcgggccttctggtcgtg
ctgtgcggccgtggccccagcgtgcgcctcttcgccctggctgagctggagagcacggag
gtggcgggcgccaagatccccgagtctcgaggctgccaggtgctggcagccggacgcatc
ctgcaggcccgcacccccgtgctctgtgtggccgtcaagcgccaggtgctgtgttaccag
ctgggtccgggcccagggccctggcagcaccgcatccgtgagctgcaggcaccggcccct
gtgcagagcctcgggctgctgggcgaccggctgtgcgtgggtgcggcgggtgcctttgcg
ctctacccgctgctcaacgaggctgcacctttagctctgggggccgatctggtgcctgag
gagctgccaccgtcccgtgggggcctgggcgaggctctgggcgctgtggaactcagcctc
aacgagttcctgctgctcttcaccaccgccggggtctacgtggacggtgccggccgcaag
tctcgcatccatgagctgctgtggccagcagtgcccacgggctggggttacgcagccccc
tacctgacagtgttcagtgagaactccatcgatgtgtttgacgtcaggaaagcagagtgg
gtccagacggtgccactcaagaaggtgcgacccctgaacccagagggctccctgttcctc
tatggcaccgagaaggtccgcctgacctacctcaggaaccggctggcagagaaggacgag
ttcgacatccccgatctcaccgacaacagccggcgccagctgttccgtaccaagagcaag
cgccgcttcttcttccgcgtgtcggaggagcagcggcagcagcagcgcagggagatgctg
aaggacccttttgtgcgctccaagctcatctcatcgcccaccaacttcaaccacctggtg
cacatgggccctatggacgggaagcccagcgccaggaacccgccccgggctccggaagag
aagggccgagggtcccgcagctccggcccgcagcggccccacagcttctcggaggcctcg
cggcgcccagcgtccatgggcagcgacggccttgccggagacgcggaccccaaagtgaag
aggaagccttggacatctctctccagcgagtccgtgtcctgcccccagggatctctgagc
ccggcagcctccctgacacaggtctcagaacggccccggagcctcccgcccgcccctgaa
ccagagagctccccttga

DBGET integrated database retrieval system