KEGG   Equus caballus (horse): 100056618
Entry
100056618         CDS       T01058                                 

Gene name
TRHR
Definition
(RefSeq) thyrotropin-releasing hormone receptor
  KO
K04282  thyrotropin-releasing hormone receptor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04020  Calcium signaling pathway
ecb04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100056618 (TRHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100056618 (TRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ecb04030]
    100056618 (TRHR)
G protein-coupled receptors [BR:ecb04030]
 Rhodopsin family
  Peptide
   Thyrotropin-releasing hormone (TRH)
    100056618 (TRHR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 100056618
NCBI-ProteinID: XP_001495334
Ensembl: ENSECAG00000023156
VGNC: 24490
UniProt: F6WCI0
Position
9
AA seq 398 aa
MENETVSELNQTQLQPRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVVSCG
YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTH
KNKNLNSKTSNRGFNSTVSSRKQVTKMLAVVVVLFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKPANYSVALNYSVIKES
DHFSTELDDITVTDTYLSAAKVSFNDTCLASEITFSQS
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggaaaacgagacagtaagtgaactgaaccaaacccagctccagccacgagcagtcgtg
gccctagaataccaagtggtcaccatcctacttgtgctcattatttgtggtctgggcatc
gtgggcaacatcatggtggtcctggtggtcatgagaaccaagcacatgaggacacccaca
aactgctacctggtgagtctggcagtagccgatctcatggtcctggtggctgcaggcctc
cccaacataacagacagtatctacggttcctgggtctatggctatgttggatgcctctgc
attacttacctccagtacttgggcatcaatgcatcctcttgttcaatcacagcctttacc
attgagaggtacatagcgatctgtcaccccatcaaagcccagtttctctgcacattttcc
agagccaaaaagatcatcatctttgtctgggctttcacatccatttactgtatgctctgg
ttcttcttgctggatctcaatattagcacctacaaagatgctattgtggtgtcctgtggc
tacaagatctccaggaattactactcacctatttacctaatggattttggtgtcttttat
gttgtgccgatgatcctggccactgtcctctatgggttcatagctaggatcctcttctta
aatcctattccttcagatcctaaagaaaactctaagacatggaaaaatgactcaacccat
aagaacaagaatttgaattcaaaaacctctaatagaggtttcaacagcacagtatcttca
aggaagcaggtcaccaagatgctggcagtggttgtagttctgtttgcccttttatggatg
ccctacagaactcttgtggttgtcaactcatttctctccagccctttccaagaaaattgg
ttcttgctcttttgcagaatttgcatttatctcaacagtgccatcaacccagtgatttac
aatctcatgtcccagaaattccgtgcagccttcagaaaactctgcaattgcaagcagaag
ccgacagagaaacccgctaactacagtgtggccctgaattacagcgtcatcaaagagtcc
gatcacttcagcacagagctcgatgatatcactgtcactgacacttatttgtctgccgcg
aaagtgtcttttaatgacacctgcttggcttctgaaataacctttagccaaagctga

DBGET integrated database retrieval system