KEGG   Equus caballus (horse): 100056650
Entry
100056650         CDS       T01058                                 
Symbol
KLKB1
Name
(RefSeq) plasma kallikrein isoform X2
  KO
K01324  plasma kallikrein [EC:3.4.21.34]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100056650 (KLKB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100056650 (KLKB1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.34  plasma kallikrein
     100056650 (KLKB1)
Peptidases and inhibitors [BR:ecb01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100056650 (KLKB1)
SSDB
Motif
Pfam: Trypsin PAN_1 PAN_4 Trypsin_2 DUF1986 PAN_2
Other DBs
NCBI-GeneID: 100056650
NCBI-ProteinID: XP_001490356
Ensembl: ENSECAG00000009884
VGNC: 19490
Position
27:complement(24089173..24121677)
AA seq 637 aa
MISFRQAAYFICLFATVSCGCLTQLYKNIFFRGGDVTAMYTPSAQHCQMMCTFHPRCLLF
SFLPENSANDIDKRFGCFLKDSVTGTLPRVSRRSAISGHSLKQCGHQISACHQDIYKGID
MRGVNFNVSKVNSVEECQKRCTDSIHCQFFTYATQTFASVEHRNNCLLKHSPGGTPTSIK
VLANVASGFSLKPCALSQIGCHMDMFQHLAFSDVDVARVTTPDAFVCQTICTYNPNCLFF
TFYTNAWNIESQRNVCFLKTSQSGTPSSPTPRENTISGYSLLTCKRTLPEPCHSKIYSGV
DFQGEELNVTFVKGANACQETCTKMVRCQFFTYSLLPEDCRGEKCKCSSRLSLDGSPTRI
THGRQASSGYSLRLCKNEDNSACGTKTNLRVVGGTNSTWGEWPWQVSLQTMLTTQNHLCG
GSIIGHQWVLTAAHCFDGLRLSAVWRIYGGILHLSEITKETPFSQIKEIIIHPNYKISEN
GHDIALIKLEVPLNYTESQKPICLPFKDDANTIYTNCWVTGWGYTKEKGEIQNTLQKANL
PLVTNEECQKRYRDHEITKQMICAGYKEGGKDACKGDSGGPLVCKHNGIWHLVGVTSWGE
GCARREQPGVYTKVAEYRDWILEKTQSQDGQSLKSRA
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgatttcattcaggcaagcagcttatttcatttgcttatttgctacagtttcctgcgga
tgcctgactcaactgtataaaaatatcttcttcagaggtggggatgtaaccgccatgtac
accccaagcgcccaacactgtcagatgatgtgtacgttccatcctaggtgtttgctgttt
agttttcttcctgaaaattcagccaatgacatagacaaaaggtttggttgctttttgaaa
gacagtgttacaggaacgctaccgagagtgtcacggagaagtgcaatttctggacattcc
ttaaagcaatgtggtcatcaaataagcgcttgccaccaagacatttataaaggaattgat
atgagaggagtcaattttaatgtatctaaggttaatagtgttgaagaatgccaaaaaagg
tgcactgatagcattcactgccaatttttcacatacgccacgcaaacattcgccagtgtg
gagcaccggaacaactgtctattaaaacacagtccaggaggaacacccaccagtataaag
gtgctggctaatgtggcatctggattctcactgaagccctgtgcactctcacaaattggt
tgccacatggacatgttccaacatctcgcgttctcagacgtggatgtggccagagttacc
actccggatgcttttgtgtgtcaaaccatttgcacctataatcccaactgcctcttcttc
acgttctacacaaatgcatggaatatagaatcacaaagaaatgtttgtttccttaagact
tcccaaagtgggacaccgagttcccctacccctcgggaaaacaccatatctggatacagt
cttttaacctgcaaacgaactttgcctgagccttgccattccaaaatttactcaggagtt
gatttccaaggggaagaattgaacgtgaccttcgttaaaggagcgaatgcctgccaggag
acttgtacaaagatggttcgctgtcagttttttacgtattctttactcccagaagactgt
agaggagagaagtgtaagtgttcctcacgactgtccttggatggctccccaactagaatt
acacacgggagacaagcgagctctggttactccttgaggttgtgtaaaaatgaggacaac
tctgcctgcggaacaaaaacaaacctacgtgtggttggaggaaccaactctacttggggg
gaatggccctggcaggtgagcctgcaaacgatgctgacaactcagaaccacctgtgtgga
gggtcaatcattggacaccagtgggtcctaactgctgcccattgctttgatgggctccgc
ttgtcggctgtttggcgcatttatggtggcattttacatctgtcagagataacaaaagaa
acgcctttctcacaaataaaagagattattattcacccaaattataaaatctcagaaaat
ggtcatgatattgccttaataaaacttgaggttcctctgaattatactgaatcccaaaaa
ccaatctgcctacctttcaaagatgatgcaaatacaatttataccaactgttgggtaact
ggatggggctacacaaaggaaaaaggtgaaattcaaaataccctgcaaaaggcaaatctt
cctttggtaacaaatgaagaatgtcaaaaaaggtacagagatcatgaaataaccaagcag
atgatctgtgctggctataaagaaggaggaaaggatgcctgtaagggggattcaggtggt
cctttagtctgtaaacacaacggcatatggcacctggtgggcgtcacgagttggggtgaa
ggctgtgcccgcagagaacaaccaggggtctacactaaagttgctgaatacagggactgg
attttagagaaaacacagagccaggatggacagtctttgaagtcacgagcatga

DBGET integrated database retrieval system