KEGG   Equus caballus (horse): 100056740Help
Entry
100056740         CDS       T01058                                 

Gene name
CAMK1D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D isoform X2
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04020  Calcium signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04925  Aldosterone synthesis and secretion
ecb05214  Glioma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100056740 (CAMK1D)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100056740 (CAMK1D)
   04925 Aldosterone synthesis and secretion
    100056740 (CAMK1D)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    100056740 (CAMK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100056740 (CAMK1D)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100056740 (CAMK1D)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   100056740 (CAMK1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo RIO1 APH 5_nucleotid Tyrosinase Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 100056740
NCBI-ProteinID: XP_001499153
Position
29
AA seq 385 aa AA seqDB search
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSLENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLAGQKDCLAPSTLCSFISSS
SGVSGVGAERRPRPTTVTTVHSGSK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggagaacggcgagagcagctcctcctggaaaaagcaagccgaagacatcaag
aaaattttcgagttcaaggagaccctcggaaccggggcgttttctgaagtggtcttggcc
gaagagaaggcaactggaaaactctttgcggtgaagtgcatccccaagaaggcgctgaag
ggcaaggaaagcagcctggagaacgagatagcagtcttgagaaagattaagcatgaaaac
attgttgccctggaagacatttatgaaagcccaaatcacctgtacttggtcatgcagctt
gtgtccggtggcgagctgtttgatcggatagtggagaagggattttacacagagaaagat
gccagcactctgatccgccaggtcttggatgctgtctactatctccataggatgggcatt
gtccacagggacctcaagcccgaaaatctcttgtactacagtcaagatgaggagtctaaa
ataatgatcagcgactttggattgtcaaaaatggagggcaagggagacgtaatgtccaca
gcctgtggaaccccaggctatgttgctcctgaggtccttgcccagaaaccttacagcaaa
gctgttgactgctggtccattggggtgattgcctatatcttgctctgtggctaccctcct
ttttatgatgaaaatgactccaagctctttgaacagatcctcaaggcagaatatgagttc
gactccccatactgggatgacatctccgactctgcaaaagacttcattcggaatctgatg
gagaaagatcccaataaaagatacacatgtgagcaagcagctcggcacccatggatcgcc
ggtgacacagccctcaataaaaacatccacgaatccgtcagcgcccagatccggaagaac
ttcgcaaaaagcaaatggagacaagcatttaatgccacagccgtggtaagacatatgagg
aaactacatcttggcagcagcctggacagttcaaatgcaagtgtttcgagcagcctcagt
ttggccggccaaaaagattgtctggcaccctccacgctctgcagtttcatttcctcttcg
tcgggggtctcaggagtgggagcggagcggaggccgaggcccaccactgtgacgacagtg
cactctggaagcaagtga

DBGET integrated database retrieval system