KEGG   Equus caballus (horse): 100057085Help
Entry
100057085         CDS       T01058                                 

Gene name
PYGB
Definition
(RefSeq) glycogen phosphorylase, brain form isoform X1
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00500  Starch and sucrose metabolism
ecb01100  Metabolic pathways
ecb04217  Necroptosis
ecb04910  Insulin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100057085 (PYGB)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    100057085 (PYGB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100057085 (PYGB)
   04922 Glucagon signaling pathway
    100057085 (PYGB)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100057085 (PYGB)
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     100057085 (PYGB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase Fringe
Motif
Other DBs
NCBI-GeneID: 100057085
NCBI-ProteinID: XP_023481725
Ensembl: ENSECAG00000022048
VGNC: 22061
Position
22
AA seq 843 aa AA seqDB search
MAKPLTDSEKRKQISVRGIAGLGDVAEVRKSFNRHLHFTLVKDRNVATPRDYFFALAHTV
RDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDL
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKIVNGWQVEEA
DDWLRYGNPWEKARPEYMLPVHFYGRVEHTPEGVRWLDTQVVLAMPYDTPVPGYKNNTVN
TMRLWSAKAPNDFKLHDFNVGGYIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAIQLNDTHPALAIPELMRILVDVEKV
DWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKLLPRHLDIIYAINQRHLDHVAALFP
GDVDRLRRMSVIEEGDCKRINMAHLCVIGTHAVNGVARIHSEIVKQSVFKDFYELEPEKF
QNKTNGITPRRWLLLCNPGLADTIVEKIGEGFLTDLSQLKKLLPLASDEALIRDVAKVKQ
ENKLKFSAFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVVTLYNRIKKDPARPFV
PRTVMIGGKAAPGYHMAKMIIKLVTSIGDVVNHDPVVGDRLKVIFLENYRVSLAEKVIPA
ADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLRVEDVE
ALDQKGYHAREYYDRLPELRQAVDQISSGFFSPKEPDCFKDVVNMLLNHDRFKVFADYEA
YMACQAQVDQLYRNPKEWTKKVIKNIACSGKFSSDRTITEYARDIWGVEPSDLQIPPPNL
PKD
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagccgctgacggacagcgagaagcggaagcagatcagtgtgcgcgggatcgcg
gggctgggcgacgtggccgaggtgcggaagagcttcaaccggcacctgcacttcacgctg
gtcaaggaccgcaacgtggccacgccccgcgactacttcttcgcgctggcgcacaccgtg
cgcgaccacctggtgggccgctggatccgcacgcagcagcactactacgagcgcgacccc
aagcgcatctattatctttccctggaattctacatgggccgcacgctgcagaacacaatg
gtgaacctgggccttcagaatgcttgtgacgaagccatctatcagttggggttggacttg
gaagaactcgaggaaatagaagaggatgccggccttgggaacggaggcttggggaggctg
gcagcctgcttccttgactcgatggccaccttgggcctggcagcatacggctatggaatc
cgctatgagtttggcatttttaaccagaagattgtcaatggctggcaggtggaggaggcc
gatgactggctgcgctacggcaacccctgggagaaagcccggcccgagtacatgcttcct
gtgcacttctatgggagagtggagcacacccccgagggcgtgaggtggctggacacacag
gtggtgctggccatgccctacgacaccccagtgccgggctacaagaataacaccgttaac
accatgaggctgtggtccgccaaggcgcccaatgacttcaagctccacgactttaacgtg
ggtggctacatcgaggcggtcctggacaggaacttggccgagaacatctctagagtcctg
tatccgaatgacaacttctttgaggggaaggagctccgcctgaagcaggagtactttgtg
gtggctgccaccctccaggacatcattcgccgcttcaagtcctccaagttcggctgccgg
gatccagtgagaacttgtttcgagacgttcccagacaaggttgccatccagctgaacgac
acccacccggcccttgccatccccgagctcatgcgcatcctggtggacgtggagaaagtg
gactgggacaaggcctgggaaatcacaaagaagacctgtgcgtacaccaaccacactgtg
ctgccggaggccttggagcgctggcctgtgtccatgtttgagaagctgctgccgaggcac
ctggacatcatctatgccatcaaccagaggcacctggatcacgtggccgccctcttccct
ggcgatgtggaccgcctgcggaggatgtctgtcatcgaggagggggactgcaagcggatt
aacatggcccacctgtgcgtgatcggcacccacgctgtcaacggcgtggcaaggatccac
tcggagatcgtgaagcagtcagtctttaaggatttttacgagctagagccagagaagttc
cagaacaagacgaacggcatcacgccgcggcggtggctgctcctgtgcaacccaggcctg
gctgacaccatcgtggagaaaattggggagggtttcctgaccgacctgagccagctaaag
aagctgctgccgttggccagtgacgaggcactcatcagggatgtggccaaggtcaagcag
gaaaacaagctcaagttctctgccttcctggagaaggagtacaaggtgaagatcaacccc
tcctccatgttcgatgtgcatgtgaagaggatccatgagtacaagcggcagctgctgaac
tgcctgcacgtggtcaccctgtacaaccgaataaagaaggacccggccaggccctttgtg
cccaggactgtcatgattgggggcaaggcagcccctggttaccacatggctaagatgatc
atcaagctggtcacgtccatcggcgatgtcgtcaaccatgatccagttgtgggcgacagg
ctcaaagtgatcttcctggagaactaccgtgtgtccttggccgagaaagtgatccccgcc
gcagacctgtcgcagcagatctccacggcgggcactgaggcctcaggcacgggcaacatg
aagttcatgctcaacggggccctcaccatcggcaccatggacggggccaacgtggagatg
gctgaggaagccggggccgagaacctcttcatctttggcctgcgggtggaggacgttgag
gctctggaccagaaagggtaccatgccagagagtactacgaccgcctgcccgagctgagg
caggctgtggaccagatcagcagcggcttcttctcccccaaagagccagactgctttaag
gatgttgtcaacatgctgttgaaccacgacaggttcaaagtgtttgcggattatgaagca
tacatggcctgccaggcccaggtggaccagctctaccggaaccccaaggagtggaccaag
aaggtcatcaagaacattgcctgctcgggcaagttctccagcgaccggaccatcacggag
tacgcgcgggacatctggggcgtggagccctctgacctgcagatcccgccccccaatctc
cccaaggactag

DBGET integrated database retrieval system