KEGG   Equus caballus (horse): 100057280
Entry
100057280         CDS       T01058                                 

Symbol
ENGASE
Name
(RefSeq) cytosolic endo-beta-N-acetylglucosaminidase isoform X1
  KO
K01227  mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase [EC:3.2.1.96]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100057280 (ENGASE)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.96  mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
     100057280 (ENGASE)
SSDB
Motif
Pfam: Glyco_hydro_85
Other DBs
NCBI-GeneID: 100057280
NCBI-ProteinID: XP_014591970
Ensembl: ENSECAG00000019553
VGNC: 17579
Position
11:complement(3688947..3698776)
AA seq 732 aa
MAAGAAAGPAAAAEKVGERPGGQNRRPQPRGGPSGRSRIEEEQEEAVFRQVVSFSPEPLP
GRYYDKDTTKPISFYLSSLEELLAWTPNVEDGFNVALQPSECRQPPLSSRRPRTLLCHDM
MGGYLDDKFIQGAAVHNPYSFYHWQYIDIFVYFSHHTVTIPPVGWTNAAHRHGVCVLGTF
ITEWIAGGQLCEAFLAGDERSYQAVADQLVSLARFFRFDGWLINIENSLSLAAVGNMPRF
LRYLTTQLHQHVPRGLVLWYDSVVSSGQLKWQNELNEHNRVFFDSCDGFFTNYNWREEHL
ERMLALAGERLADVYVGVDVFARGNVVGGRFDTDKSLELIRKHGFSAALFAPGWVYECLE
KKDFFQNQDKFWSLLERYLPTHSICSLPFVTSFCLGMGTRRVCYGQEEAVGPWYHPSAQE
IQPLFGEHRLEGARQGWVKTHCCLADAWNGGSSLLIRGAIPREVGDVAVRLFSLQVPVPP
RIFLSMVYKLEGPSDVGVALELTTGSVGSCHIGGISALNAETSSRYSPRPLRVPPAKLAR
WVGHCGQQLRGGWIQRCYEVSLRGCLLQDLFVRFSRLPGSQEEDFVCRLGEIQVVDAGSL
LKALPRVQAVSVSHLRWQQAASEGEGHPAGLQLSCTLHWSYLLSHVRCFRVHCCRGTAGC
SAGGGPPGPERPTLLGLAFVNQYRIVDLAVAAIGPGQDGRVEFLVEPVPKEGFLVPQAEW
GRAAMLYSMPAS
NT seq 2199 nt   +upstreamnt  +downstreamnt
atggcggcgggagcggcggccgggccggcggcggccgcggagaaggtgggcgagaggccg
ggcgggcaaaaccggaggccccagccccgcggcgggccgtcgggccggagtcgaatcgag
gaggagcaagaagaggcagtcttccgtcaggtggtcagttttagcccggagcctttgcca
ggtagatattatgacaaggacaccaccaagcccatcagcttttacttgtcttccctggag
gagctcttggcatggacgcccaatgtggaggacggcttcaacgtggccttgcagccctcc
gagtgtcgccagccccctctgagcagccgcaggccccggacattgttgtgccatgacatg
atgggcgggtacctggatgacaagtttattcagggcgcggcagtgcacaatccttactcc
ttctaccactggcagtacattgacatctttgtgtacttcagccatcacaccgtcaccatc
cccccggtgggctggaccaatgccgcccacaggcacggagtctgtgtgctggggactttc
atcaccgagtggatagcaggtgggcagctctgtgaagccttcctggccggggacgagcgc
tcgtaccaggcggtggctgaccagctggtctcgcttgcccggtttttccgatttgatggc
tggctgatcaacattgagaactcgctgagtctggccgcagtggggaatatgccccgtttc
ctccggtatctgaccactcagctacaccagcatgttccgaggggcttggttctctggtat
gacagcgtggtgagcagcgggcagctcaaatggcagaatgaactgaacgagcacaacagg
gttttcttcgattcctgtgacggcttcttcaccaactacaactggcgggaggagcatctg
gagcggatgctggcgctagccggggagcgcctggccgatgtgtacgtgggcgtcgacgtg
ttcgcccgggggaacgtcgtagggggtcgatttgacacggacaagtccctggagctgatc
cggaagcatgggttctcggcggctctctttgctcctggctgggtgtacgagtgtctggag
aagaaggatttcttccagaaccaggacaagttctggagtttgctggaacgctatctgccc
acgcacagcatctgttccttgccctttgtcacctctttctgcctgggcatggggactcgg
agagtctgctatggccaggaggaggcggtggggccctggtaccaccccagcgcccaggaa
atccagcccctctttggagagcacaggctggaaggggccagacagggctgggtgaagacc
cactgttgcctggcggatgcctggaacggcggcagctccctgctcatccggggggcgatt
ccgcgtgaggttggagatgtggctgtgaggttattctccctgcaggtccccgtgccgccc
agaatcttcctgtccatggtgtacaagctcgaagggccttcggatgtcggggtggccctg
gagctcaccacagggagtgtgggcagctgtcacatcggtggcatctcagccttgaacgca
gaaacaagctcacggtacagcccccggcccctccgggtgccccctgccaagctggctaga
tgggtgggccactgcggccagcagctccgcgggggctggatccagcgatgctacgaggtg
agcctgcgcggctgcctcctgcaggacctctttgttcgtttctcacggcttccgggcagc
caggaggaggacttcgtctgtcgccttggagaaatccaggtggtggacgccggcagcctg
ctgaaggctctgccgcgggtgcaggcagtctctgtctcccacttgcgctggcagcaggct
gcctctgagggcgagggccaccctgccggcctccagctcagctgtactctgcactggtcc
tacctgctctcccacgtccgatgcttccgggtccactgctgcagagggacagccggctgc
tctgctggcggggggccaccggggcccgagaggcccacgctcctgggcctggcttttgtc
aaccagtatcggatagtggacctggcagtggcagccatagggcccggccaggatggccgt
gtggagttcctcgtggagcctgtccccaaggaggggtttctggtgccgcaggccgagtgg
ggcagggcggccatgctctactccatgcctgcctcgtga

DBGET integrated database retrieval system