KEGG   Equus caballus (horse): 100057371
Entry
100057371         CDS       T01058                                 

Gene name
NMNAT1
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00760  Nicotinate and nicotinamide metabolism
ecb01100  Metabolic pathways
ecb01240  Biosynthesis of cofactors
Module
ecb_M00912  NAD biosynthesis, tryptophan => quinolinate => NAD
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100057371 (NMNAT1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     100057371 (NMNAT1)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     100057371 (NMNAT1)
SSDB
Motif
Pfam: CTP_transf_like CCDC71L ChapFlgA
Other DBs
NCBI-GeneID: 100057371
NCBI-ProteinID: NP_001296336
Ensembl: ENSECAG00000020988
VGNC: 20780
UniProt: F6TI31
Position
2
AA seq 280 aa
MENSEKTELVLLACGSFNPITNMHLRLFELAKDYMNGTGKYKVIKGIISPVGDAYKKKGL
ISAHHRVFMAQLATKNSEWVEVDTWESLQKEWVETAKVLRHHQEKLEASSCGNEQGSPVL
ERPGRKRKWAEQRQDFSQKKSLEPKTKGVPKVKLLCGADLLESFGVPNLWKSEDITQIVR
DYGLICITRAGNDAQKFIYESDVLWKYQNNIHLVNEWITNDISSTKIRQALRRGQSIRYL
VPDLVQEYIEKHDLYTSESEERNVGVILAPLQRNMAEANS
NT seq 843 nt   +upstreamnt  +downstreamnt
atggagaattcagagaagacagaattggttctccttgcctgtggttcctttaatcctatc
actaacatgcacctcaggttatttgaactggccaaggactacatgaatggaacaggaaaa
tataaagttatcaaaggcataatttctcctgttggcgatgcatataagaagaaaggactc
atctctgcccatcaccgagttttcatggcacaacttgccaccaagaattcagaatgggtg
gaagttgatacgtgggaaagtcttcagaaggagtgggtagagactgctaaggtgctcaga
caccatcaagagaaactagaggctagtagctgtggtaacgagcagggctcacctgtgctg
gaaaggcctggacggaagaggaagtgggctgaacaaagacaagattttagtcaaaagaaa
tccctagagccaaagactaaaggtgtgccaaaggtaaagctgctgtgtggggcagattta
ctggagtcctttggtgttcccaatctgtggaagagtgaggatatcacccaaattgtgcga
gactatgggctcatatgtattactcgggctggaaatgatgctcagaaattcatctatgaa
tccgatgtgctgtggaaataccagaacaacattcatctggtgaatgaatggatcaccaat
gacatctcatccacaaagatccggcaagccctcagaaggggccagagcattcgctacttg
gtaccagatcttgtccaagaatatattgagaagcatgatttgtatacctctgagagtgaa
gagaggaatgtcggggttattctggctcctttgcagagaaacatggcagaagctaactca
taa

DBGET integrated database retrieval system