KEGG   Equus caballus (horse): 100057450
Entry
100057450         CDS       T01058                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X2
  KO
K04462  ecotropic virus integration site 1 protein
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb05200  Pathways in cancer
ecb05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100057450 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100057450 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100057450 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100057450 (MECOM)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    100057450 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 Zn-ribbon_8 zf-C2H2_11 zf-met PyrI_C zinc_ribbon_15
Other DBs
NCBI-GeneID: 100057450
NCBI-ProteinID: XP_003363432
Ensembl: ENSECAG00000020788
VGNC: 20065
Position
19
AA seq 1239 aa
MRSKGRARKLATSNECVYGSYPEIPLEEMPDADGVVNTPSLNIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDP
SYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLEGENDLREIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATS
SGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSL
NKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLT
FPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQD
ILKALSKHPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSD
LESDIESDKEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPSLEEQTAVSGAVND
SIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRALPL
KMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKAPVTPVTSQDQPLDLSMGSR
SRASGTKLTEPRKNHVFGEKKGSNVEPRLASDGSLQHARPTPFFMDPIYRVEKRKLTDPL
EALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMF
NFRAPPSALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSI
SSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELEST
GAILDDKEDAYFTEIRNFIGNSNHSSQSPRNTEERMNGSHFKDEKALVASQNSDLLDDEE
AEDEVLLDEEDEDNDITGKTGKEPVTGNLHEGSPEDDYEETSALEMSCKTSPVRYKEEEY
KTGLSALDHIRHFTDSLKMRKMEDNQYTEAELSSFSTSHVPEELKQPLHRKSKSQAYAMM
LSLSDKESLHSTSHSSSNVWHSMARTAAESSAIQSISHV
NT seq 3720 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgtatatggcagt
taccctgaaattcctttggaagagatgccagatgcagatggagtagtcaacactccctcc
ctcaatattcaagagccatgctctccagccacgtccagcgaagcattcactccaaaggag
ggctctccttacaaagcccccatctacatccctgatgatatccctattcctgctgagttt
gagcttcgagagtcaaatatgcctggagcaggactaggaatatggaccaaaaggaagatt
gaagtaggtgaaaagtttgggccttatgtgggagagcagaggtcaaacttgaaagacccc
agttatggatgggagatcttagatgagttttgcaatgtgaagttctgcatagatgctagt
caaccagatgtaggaagctggctcaagtacatcaggttcgctggctgttatgatcagcac
aacctcgttgcatgccagataaatgatcagatcttttatagagtagtggcagacattgca
ccgggagaggagctcttgctgttcatgaagagtgaagattatccccatgaaactatggcg
ccggatatccacgaagaacggcagtatcgctgtgaggactgtgaccagctctttgagtcc
aaggctgagctagcagaccatcagaagttcccgtgcagcactccccactcagcgttttca
atggtggaagaggacttccaacaaaaactcgaaggtgaaaacgatctccgagagatacat
gcaatccaggagtgtaaggaatgtgaccaagtctttcctgatttgcaaagcctagagaaa
cacatgttgtcacatactgaagagagggagtacaagtgcgatcagtgtcccaaggccttt
aactggaagtccaatttaattcgccaccagatgtcacatgacagtggaaagcactatgaa
tgtgaaaactgtgccaaggtgttcacggaccctagcaacctccagcggcacattcgctct
cagcacgttggtgcccgggcccacgcttgcccggagtgtggcaaaacgtttgccacttcg
tcgggcctcaaacagcacaagcacatccacagcagtgtgaagccctttatctgtgaggtc
tgccataaatcctatactcagttttcaaacctttgtcgtcataagcgcatgcatgctgat
tgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttcctta
aataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggattttttggc
caaggcatttcacttcctggaaccccagctatggataaaacgtccatggttaatatgagt
catgccaacccgggccttgctgactattttggcgccaataggcatcctgctggtcttacc
tttccaacagctcctggattttcttttagcttccctggtctgtttccttccggcttgtac
cacaggcctcctttgatacctgctagttctcctgttaaaggactatcaagtactgaacag
acaaacaaaagtcaaagtcccctcatgacacatcctcagatactgccagctacacaggat
attttgaaggcactatctaaacacccacctgtaggggacaataagccagtggagctccag
cccgagaggtcctctgaagagaggccccttgagaaaatcagtgaccagtcagagagtagt
gaccttgatgatgtcagtacgccaagtggcagtgacctggagacaacctcgggctctgat
ctggaaagtgacattgaaagtgataaagagaaatttaaagaaaatggtaaaatgttcaaa
gacaaagtaagccctcttcagaatctggcttcaatacataataagaaagaatacagcaat
cattccattttctcaccatctttagaggagcaaaccgcggtgtcaggagctgtgaatgat
tctataaaggctattgcttctattgctgaaaaatactttggttcaacaggactggtgggg
ctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctcccgtttttt
ccagcattctctcaatcaatgtacccatttcctgatagagacttgagagcgttacctttg
aaaatggaaccccaatcaccaagtgaagtaaagaaactgcagaagggaagctctgagtct
ccctttgatctcaccactaagcgaaaggacgagaagcccttgactccagtaccctccaag
gctccagtgacgcctgtcacaagccaagaccagcccctggatctaagtatgggcagtagg
agtagagccagtggaacaaagctgactgagcctcgaaaaaaccacgtgtttggggaaaag
aaaggaagcaatgttgaaccaagactcgcgtcagatggttccttgcagcatgctagaccc
actcctttctttatggaccctatttacagagtagagaaaagaaaactaactgacccactt
gaagctttaaaagagaaatacttgagaccttctccaggattcttatttcacccacaattc
caactgcctgatcagagaacttggatgtcagctattgaaaacatggcggagaagctggag
agcttcagtgccctgaaacctgaggccagtgaactcctgcagtcagtcccctccatgttc
aacttcagagcgcctcccagcgccctgccagagaccctgctgcggaaaggcaaagagcgc
tacacctgcagatactgtggcaagatttttccaagatctgcgaacctcacacggcacttg
agaacccacacgggagagcagccttacagatgcaaatactgtgacagatcgtttagcata
tcttctaacttgcagcggcacgttcgcaacattcacaataaggagaagcccttcaagtgt
cacttatgtgataggtgtttcggtcaacaaaccaacctagacagacacctaaagaaacat
gagaatgggaacatgtctggtacggcaacatcatcgcctcattctgaactggaaagtaca
ggtgccattctcgatgacaaagaagatgcttacttcacagaaattcgaaatttcattggg
aatagcaaccacagcagccagtctcccaggaacacagaggagagaatgaatggcagtcac
tttaaggatgaaaaggctttggtggccagtcagaattcagatttactggatgatgaagaa
gcagaagatgaagtgttgttagatgaggaggatgaagacaacgatattactggaaaaacg
ggaaaggaaccagtgaccggtaatttgcatgaaggaagccctgaggatgattacgaagaa
accagcgccctggagatgagttgcaagacgtccccagtgaggtataaagaggaagaatat
aaaactggactttctgctctagatcatataaggcacttcacagatagcctcaaaatgagg
aaaatggaagataatcaatatactgaagctgagctgtcttcttttagtacttcccatgta
ccggaggagcttaaacagccgttacacagaaagtccaaatcacaggcatatgctatgatg
ttgtcattgtccgacaaggagtccctccattccacatcccacagttcttccaacgtgtgg
cacagtatggcaaggactgcggcggaatccagtgccatccagtccataagccacgtatga

DBGET integrated database retrieval system