KEGG   Equus caballus (horse): 100057483Help
Entry
100057483         CDS       T01058                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
ecb  Equus caballus (horse)
Pathway
ecb01523  Antifolate resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04137  Mitophagy - animal
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04218  Cellular senescence
ecb04380  Osteoclast differentiation
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04623  Cytosolic DNA-sensing pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04668  TNF signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04917  Prolactin signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04926  Relaxin signaling pathway
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05030  Cocaine addiction
ecb05132  Salmonella infection
ecb05133  Pertussis
ecb05134  Legionellosis
ecb05140  Leishmaniasis
ecb05142  Chagas disease (American trypanosomiasis)
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  HTLV-I infection
ecb05167  Kaposi's sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05212  Pancreatic cancer
ecb05215  Prostate cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05321  Inflammatory bowel disease (IBD)
ecb05418  Fluid shear stress and atherosclerosis
Module
ecb_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100057483 (RELA)
   04010 MAPK signaling pathway
    100057483 (RELA)
   04064 NF-kappa B signaling pathway
    100057483 (RELA)
   04668 TNF signaling pathway
    100057483 (RELA)
   04066 HIF-1 signaling pathway
    100057483 (RELA)
   04071 Sphingolipid signaling pathway
    100057483 (RELA)
   04024 cAMP signaling pathway
    100057483 (RELA)
   04151 PI3K-Akt signaling pathway
    100057483 (RELA)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    100057483 (RELA)
  Cell growth and death
   04210 Apoptosis
    100057483 (RELA)
   04218 Cellular senescence
    100057483 (RELA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100057483 (RELA)
   04621 NOD-like receptor signaling pathway
    100057483 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100057483 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100057483 (RELA)
   04625 C-type lectin receptor signaling pathway
    100057483 (RELA)
   04660 T cell receptor signaling pathway
    100057483 (RELA)
   04658 Th1 and Th2 cell differentiation
    100057483 (RELA)
   04659 Th17 cell differentiation
    100057483 (RELA)
   04657 IL-17 signaling pathway
    100057483 (RELA)
   04662 B cell receptor signaling pathway
    100057483 (RELA)
   04062 Chemokine signaling pathway
    100057483 (RELA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    100057483 (RELA)
   04917 Prolactin signaling pathway
    100057483 (RELA)
   04926 Relaxin signaling pathway
    100057483 (RELA)
  Nervous system
   04722 Neurotrophin signaling pathway
    100057483 (RELA)
  Development
   04380 Osteoclast differentiation
    100057483 (RELA)
  Aging
   04211 Longevity regulating pathway - mammal
    100057483 (RELA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100057483 (RELA)
   05202 Transcriptional misregulation in cancers
    100057483 (RELA)
   05203 Viral carcinogenesis
    100057483 (RELA)
   05212 Pancreatic cancer
    100057483 (RELA)
   05221 Acute myeloid leukemia
    100057483 (RELA)
   05220 Chronic myeloid leukemia
    100057483 (RELA)
   05215 Prostate cancer
    100057483 (RELA)
   05222 Small cell lung cancer
    100057483 (RELA)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    100057483 (RELA)
  Substance dependence
   05030 Cocaine addiction
    100057483 (RELA)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100057483 (RELA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100057483 (RELA)
   04931 Insulin resistance
    100057483 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100057483 (RELA)
  Infectious diseases
   05132 Salmonella infection
    100057483 (RELA)
   05133 Pertussis
    100057483 (RELA)
   05134 Legionellosis
    100057483 (RELA)
   05152 Tuberculosis
    100057483 (RELA)
   05166 HTLV-I infection
    100057483 (RELA)
   05162 Measles
    100057483 (RELA)
   05164 Influenza A
    100057483 (RELA)
   05161 Hepatitis B
    100057483 (RELA)
   05160 Hepatitis C
    100057483 (RELA)
   05168 Herpes simplex infection
    100057483 (RELA)
   05163 Human cytomegalovirus infection
    100057483 (RELA)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100057483 (RELA)
   05169 Epstein-Barr virus infection
    100057483 (RELA)
   05165 Human papillomavirus infection
    100057483 (RELA)
   05146 Amoebiasis
    100057483 (RELA)
   05145 Toxoplasmosis
    100057483 (RELA)
   05140 Leishmaniasis
    100057483 (RELA)
   05142 Chagas disease (American trypanosomiasis)
    100057483 (RELA)
  Drug resistance
   01523 Antifolate resistance
    100057483 (RELA)
Transcription factors [BR:ecb03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100057483 (RELA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer
Motif
Other DBs
NCBI-GeneID: 100057483
NCBI-ProteinID: XP_023510230
Ensembl: ENSECAG00000013763
VGNC: 22293
Position
12
AA seq 551 aa AA seqDB search
MEDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPARSSASVPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGTIPSQTSALAPAPAPVLAQAPAPAPAMASALAQAPAPVPVLAAGLAQAV
APPAPRTTQAGEGTLTEALLQLQFDADEDLGALLGNNTDPAVFTDLASVDNSEFQQLLNQ
GVSMAPHTAEPMLMEYPEAITRLMSGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSISDM
DFSALLSQISS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggaagacctgttccccctcatcttcccttcggagccagcccaggcttctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctcagcgggcagcatcccgggcgagaggagcacggataccaccaagacccaccccacc
atcaagatcaatggctacacggggccagggacagttcgcatctccctggtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtggggaaagactgccgggacggcttctat
gaggctgagctctgccctgaccgctgcatccacagcttccagaacctggggatccagtgt
gtaaagaagcgagacctggagcaggccatcagtcagcgcatccagaccaacaacaacccc
ttccaagttcccatagaagagcagcgtggggactacgacctgaatgcggtgcggctatgc
ttccaggtgacagtgcgggacccggcaggcaggcccctccgcctgtcgcctgtcctttct
catcccatctttgacaaccgcgcccccaacactgctgagctcaagatctgccgagtgaac
cggaactccgggagctgcctcgggggcgatgagatcttcctgctttgtgacaaggtgcag
aaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttca
caagccgatgttcaccgacaagtggccattgtgttccggacacctccctacgcggacccc
agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcggatcgggagctc
agcgagcccatggagttccagtatttgccagacacagatgatcgtcaccgaattgaggag
aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga
cccaccgacccccggcccccgccccggcgcattgctgtgcctgcccgcagctcagcctcc
gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttt
gaggaattttcccccatggtctttccttctgggacgatcccaagccagacctcggccttg
gcaccagcccctgccccagtcctggcacaggccccagcccctgccccagccatggcatca
gctctggcccaggccccagctcccgtccctgtcctagccgcaggccttgctcaggccgtg
gccccgcctgcccccaggaccacccaagctggggaagggacactgacggaggccctgctg
cagctgcagtttgatgctgatgaagacctgggggccctgctcggcaataacactgacccg
gccgtgttcacggacctggcatctgtcgacaactctgagtttcagcagctgctgaaccag
ggtgtctctatggccccccacacagctgagcccatgctgatggagtaccctgaggctata
actcgcctgatgtcagggtcccagcggccccctgacccagctcccgctcccctgggggcc
tctgggctccccaacggtctcctctcaggggacgaagacttctcctccatttcggacatg
gacttctcagcccttctgagtcagatcagctcctag

DBGET integrated database retrieval system