KEGG   Equus caballus (horse): 100057633
Entry
100057633         CDS       T01058                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100057633 (AHRR)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100057633 (AHRR)
SSDB
Motif
Pfam: PAS HLH Gag_p10 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 100057633
NCBI-ProteinID: XP_014590436
Ensembl: ENSECAG00000017812
VGNC: 15180
UniProt: F6PWR8
Position
21
AA seq 716 aa
MIPPGECMYAGRKRRKPIQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQALQEKCPWQPAAGAPLPGDGGLHEGSSVLEGRLLLESLH
GFALVVSAEGMIFYASATIMDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQV
VCGQPLRSETGEDAVLGRLLRAQEGGAGSPTEYSAFLTRCFVCRVRCLLDSTSGFLTMQF
QGKLQFLFGQKRKAPSGTVLPPRLSLFCIVVPVLLPSVAEMKMKSAFLRAKHRVDISATM
DTKAKTTTSLCESELHGKPSYLAGRSNGENSISVFRTQTDAGHWARVPARASCLCLRGGS
DLIFDPEGAAGDRGAEELGRVSSGSSSTRGQKEIHSYNCHLETSAPGKHLNWTTGKHGQD
GTQLKLEPSKRDLFSVRAVPHGSCMPYLGVQGTLHASGVTAFRNSPSSHPANHSPSAYGS
RTSRALRDRGQGQGHPPTSCPFPQGSLENGLPQPAAQHLAVGGYSTEDAKLRGVPMPPGA
LCNTMLSLDVPIKMESDSGSEDTADGYSVSPGRMWLGASEVAKRQLVTFPTRMHLKSEPD
PRHHCYTPHMGHGLLGAHPRPGRELAPFHPTQCACLEHMHGLPEPEPPPGLCARGPLPPT
LGCDCRAPGAAPVVKREPLDSPSWGPHSQGGVPGVFPKSGLATLMPPKASECTFLP
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgattccgccaggggagtgcatgtacgctggaaggaaaagaaggaagcccattcagaaa
cagaggcccgccgtgggggccgagaagtcaaacccttccaagcggcaccgggaccgcctc
aacgctgagctggaccacctggccagcctgctgccctttccacccgacatcatctctaag
ctggacaagctttcggtcctgcgcctcagcgtcagctacctcagggtgaagagcttcttc
caagccctgcaggagaagtgcccgtggcagccggcggctggtgcccccttgccaggagac
ggcggtctgcacgaagggtcctcggtgctggagggacggctgctgctggagtccctccat
ggcttcgctctggtcgtgagcgcggaaggcatgatattctacgcatcagcaaccatcatg
gactatctgggcttccaccagacggatgtgatgcaccaaaacatctacgactacatccac
gtggatgaccgtcaggacttctgccggcagctgcactgggccatggaccctccccaggtg
gtgtgtgggcagccgctgcgctcggagacaggagaggacgccgtcctgggaaggctgctc
agggcccaggaggggggtgcgggttcgcccacggagtactcggccttcctgacccgctgc
ttcgtctgccgcgtgcgctgcctgctggacagcacctcgggcttcctgacgatgcagttt
caaggaaaactgcaattcctgtttggacagaaaaggaaggcaccctcggggaccgtcctg
cccccacgactctccctcttctgcatcgtggtacctgtgctcctgccttccgtggcagag
atgaaaatgaagagtgcatttttgagggcgaagcacagggtggacatctcagcaacaatg
gacacaaaggcaaaaactaccaccagtctgtgtgaatcagaattgcacggaaaacccagt
tacttagcaggaaggagcaatggggaaaacagcatttcggtgttcaggacacagaccgat
gctggccactgggcccgggttccagccagggcctcatgcctgtgcctcaggggtggctct
gacctcatctttgaccctgagggagccgcaggggacaggggagcagaggagctcgggagg
gtgtccagtggctcctccagcacgagggggcagaaggaaatacatagttacaactgccac
ttggagacctccgcacccgggaagcacctgaattggacaacagggaaacacggtcaggat
ggcacccagctgaagctggaacccagcaagcgtgatctgttctccgtgcgtgctgtgcct
cacggttcctgcatgccctacctgggcgtccagggcaccctccatgccagtggcgtcact
gctttcaggaattcacccagctctcacccagcgaaccattcccccagtgcatacggcagc
cggacaagcagagccttgcgggaccgcggtcagggccaggggcaccctcccaccagctgc
cccttcccccaggggagcctggagaatgggctccctcagcccgcagcacagcatcttgca
gtggggggctattctaccgaggatgccaagttgcgaggtgtgccgatgcccccaggagcc
ctgtgcaacaccatgttgtcacttgatgtgcccatcaagatggagagtgactctgggtcc
gaggatacagcagatggctactctgtgtccccaggccgcatgtggctgggagccagtgag
gtggccaagagacagctggtcactttccctaccaggatgcacctgaagtcagagccagac
cccaggcaccactgctacaccccgcatatggggcatggcctgctgggggctcaccccaga
cccggcagggaactggccccgttccaccccacacagtgtgcctgcctggagcacatgcat
ggtcttcccgagccggagcccccgcccggcctctgtgcgcggggccccctgcccccgact
ctgggctgtgactgcagagctcctggagctgcacccgtcgtcaagcgtgagcccctggac
tcgccctcatggggtcctcacagccagggtggggtgcccggggtgttccccaagagtggc
ttggcaacactgatgccgcccaaggcctctgagtgcactttcctgccatag

DBGET integrated database retrieval system