KEGG   Equus caballus (horse): 100057821Help
Entry
100057821         CDS       T01058                                 

Gene name
ABHD6
Definition
(RefSeq) monoacylglycerol lipase ABHD6 isoform X2
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    100057821 (ABHD6)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100057821 (ABHD6)
Peptidases [BR:ecb01002]
 Serine Peptidases
  Family S33
   100057821 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 Lipase DLH Esterase
Motif
Other DBs
NCBI-GeneID: 100057821
NCBI-ProteinID: XP_001489315
Ensembl: ENSECAG00000007024
VGNC: 14948
UniProt: F7BVL6
Position
16
AA seq 336 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGQRPSILMLHGFSAHKDMWLSVVKFLPKNLHLICVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQCSS
DNQFIQRLRELQKSAAMEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQLLQGLVDVRIPHN
NFYRKLFLEITSEKSRYCLHQNMGKIKVPTQIIWGKQDQVLDVSGADVLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIVDFFASLYNTDNKKLD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgacgtggttaatatgtttgtgatcgcgggcgggaccttggccatcccaatc
ctggcgtttgtagcctcgtttctcctgtggccttcagcactgatcagaatctactattgg
tactggcgaaggacattgggcatgcaggtccgctatgttcaccacgaagactatcaattc
tgttactccttccgcggcagacccgggcagaggccttccatcctcatgctccacggattc
tctgcgcacaaggatatgtggctcagcgtggtcaagttccttccaaagaatctgcacttg
atctgtgtggacatgccaggacatgagggcaccacccgttcctccctggatgacctgtcc
atagatgggcaagtcaagaggatacaccagtttgtagaatgcctcaagctgaacaaaaaa
cctttccacctggtaggcacctccatgggtggccatgtggctggggtgtatgctgcttac
tacccatcggatgtctgcagcctgtctctcgtttgccccgctggcctgcagtgctcaagt
gataatcaatttatacaacggctcagagaactgcagaaatcggctgctatggagaagatt
cccttgatcccatccaccccagaagaaatgagtgaaatgctccagctctgctcctatgtc
cgcttcaaggtgccacagcagcttctgcagggccttgtcgacgtccgcatccctcataac
aacttctaccgaaagttgtttttggaaatcaccagtgagaagtcaagatactgcctccat
cagaacatgggcaagatcaaggtcccaacgcagatcatctgggggaaacaagaccaggtg
cttgatgtgtctggggcagatgtgttggccaagtcaatcgccaactgccaggtggaactt
ctggaaaactgtgggcactcagtggtgatggagagacccaggaagacagccaagctcatc
gttgacttttttgcctctctgtacaacacagacaacaagaagctagactga

DBGET integrated database retrieval system