KEGG   Equus caballus (horse): 100057963Help
Entry
100057963         CDS       T01058                                 

Gene name
FLNB
Definition
(RefSeq) filamin-B isoform X1
  KO
K04437  filamin
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04510  Focal adhesion
ecb05132  Salmonella infection
ecb05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100057963 (FLNB)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100057963 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100057963 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    100057963 (FLNB)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100057963 (FLNB)
  Intermediate filaments
   Intermediate filament-binding proteins
    100057963 (FLNB)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100057963 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filamin CH Y_Y_Y Big_3_5 Invasin_D3
Motif
Other DBs
NCBI-GeneID: 100057963
NCBI-ProteinID: XP_023475969
Ensembl: ENSECAG00000015849
VGNC: 18061
Position
16
AA seq 2602 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRENIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDLMVFVEDPEGNK
EEAQVTPANDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAHGDASKVTAK
GPGLEATGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
VQPGPHVIKVSFAGDTIPKSPFVVQVGEACSPNACRASGRGLQPKGIRIRETADFKVDTK
AAGSGELGVTVKGPKGLEELVKQKGFLDGVYAFEYYPSTPGKYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESVGSEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQPIDIQMKSRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASEEIPASPFRVKVD
PSHDASKVKAEGPGLTKSGVENGKPTHFTVYTKGAGKAPLNVQFSGPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGSMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGK
DQEFAIDTKGAGGQGKLDVTILSPSRKVMPCLVAPVAGRESSTAKFVPREEGLYAIDVTY
DGHPVPGSPYAVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLQHGKVGEAGLLSVDCSEAGPGALDLEAVSDSGAKAEVCIENNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPTRVKVEPAVDTSRVKVFGPGIEGKDVFREATTDFMIDSRPLTQ
VGGDHIKAHIANPSGASTPCFITDNADGTYQVEYTPFEKGLHVVEVAYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARIL
QSFTVDSSKAGLAPLEVRVMGPRGLVEPVNIVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVEFAIDARDAGEGLLAVQITDQE
GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDEIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEIDSSDMSAHVTSPSGRVTEAEIVPVGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHMIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLIGVKYGGPN
HIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaccgagaaggacctggcggaggacgcgccatggaagaagatccagcagaac
acgttcacgcgctggtgcaatgagcacctcaagtgcgtgaacaaacgcattgggaacctg
cagaccgacctgagcgatgggctacggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagtaccaccagcggcccaccttccgccagatgcagctggagaacgtg
tccgtggcgctcgagttcttggatcgtgagaacatcaagctcgtgtccatcgatagcaaa
gccatcgtggatgggaacctgaagctcatcttgggcctggtgtggacactgatcctccac
tactccatctccatgcccgtgtgggaggatgaaggggatgatgatgccaagaagcagaca
ccaaagcagaggctgctgggatggattcagaacaagatcccctacttgcccatcactaac
tttaaccagaactggcaagatggcaaagccctgggagccctggtagacagctgtgctcca
ggtctgtgccctgactgggagtcctgggacccacgaaagcctgtggataatgcacgagaa
gccatgcaacaggcagatgactggctgggtgtcccacaggtcatcactcctgaagaaatt
attcacccggatgtggatgagcactcggtgatgacttacctgtcccagttccccaaagcc
aagctcaagccaggggctcctcttaaacccaaactcaaccccaagaaagccagggcctat
ggcagaggaattgagcccactggaaacatggtgaagcagccggccaagttcaccgtggac
accatcagtgctgggcaaggagacctgatggtgtttgttgaggacccagaaggcaacaaa
gaagaggcacaagtgaccccagccaacgacaagaacaagacgtactctgtggagtacctg
ccgaaggtcactgggctgcacaaagtcacagtcctctttgcaggacagcacatatccaag
agcccatttgaagtgaatgttgacaaggcccatggagacgccagcaaagtcactgcgaaa
ggcccaggcttggaagctacagggaacatcgccaataagcccacctactttgacatctac
acggcaggtgctggcgtgggtgacattggtgttgaggtggaggatcctcaggggaagaac
accgtggagttgcttgtggaagacaaaggaaaccaggtgtatcgatgtgtgtacaagcca
gtgcaacctggcccccacgtaatcaaggtctccttcgctggggacaccattcccaagagt
ccctttgttgtgcaggttggggaagcctgcagtccaaacgcctgccgggccagtggccga
ggcctgcagcccaaaggcatccgtatccgggagactgcagacttcaaggttgacaccaaa
gctgccggaagtggggagctcggcgtaaccgtgaagggtcctaagggtctggaggagctg
gtgaagcagaaaggctttctggatggagtctatgcatttgaatattaccccagcaccccg
gggaaatacagcatcgccatcacgtgggggggacaccacattccaaagagcccttttgaa
gttcaagttggtcctgaagcaggcatgcagaaagtccgcgcctggggccctggcctccat
ggcgggattgttgggcgctcagcggactttgtggtggagtccgttggctctgaagtgggg
tctctggggtttgccattgaaggcccctcccaggcgaagattgagtatgacgaccagaat
gatggatcgtgtgatgtcaagtactggcccaaggagcccggtgaatatgctgttcacatc
atgtgtgacgacgaggacatcaaggacagtccatacatggctttcatccacccagccacg
ggagactacaacccggatctggtccgagcgtacgggccgggtttggagaaatctggctgt
atagtcaacaacctggccgagttcaccgtggatcctaaggatgctggaaaagctccctta
aagatttttgctcaggacggggaaggccagcccatcgacatccagatgaagagccggatg
gatggcacatatgcctgctcatataccccagttaaggccatcaagcacaccattgctgtg
gtctggggaggtgtgaacatcccacacagcccttacagggtcaacatcgggcagggtagc
catccacagaaggtcaaagtgtttgggccaggcgtggagagaagtggactgaaggcgaat
gagcctactcacttcacagtggactgtactgaggctggggaaggtgatgtcagcgttggc
attaaatgtgatgcccgggtgttaagtgaggatgaggaagacgtggattttgacattatt
cacaacgccaacgacacgtttacagtcaaatatgtgcctcctgctgctgggcgatatact
atcaaagttctctttgcgtctgaggaaatccccgccagccctttcagagtcaaagttgac
ccttcccacgacgccagcaaggtgaaggcagagggcccggggctcaccaaatcaggtgtg
gaaaacgggaaaccaacccacttcactgtctacaccaaaggggctgggaaagccccactc
aacgtgcagttcagcggcccccttcctggcgacgcagtgaaggatttggatatcattgat
aattacgactactcccacaccgttaaatacacacccacccagcagggcagcatgcaggtt
ctggttacctatggtggtgatcccatccctaaaagcccattcaccgtgggcgttgctgcg
ccactggatctgagcaagataaaaatcaatggactggaaaacagagtcgaggttgggaag
gatcaagaattcgccattgacacaaagggggcagggggccaggggaagctggacgttacg
atcctgagcccatcgaggaaggtcatgccgtgtctggtggcgcccgtggcgggccgggag
agcagcactgccaagttcgtccctcgggaggaagggctctatgctatagacgtgacctac
gatggacaccctgtgcccgggagcccctacgcagtggaggcctcgctgccacctgatccc
tccaaggtgaaggcccatggtcctggccttgaaggtggtctcgtgggcaagcctgccgag
ttcaccatcgacaccaaaggagctgggactggaggtttgggcctaactgtggaaggtcca
tgcgaggccaaaattgagtgctctgacaatggcgatgggacctgctctgtctcgtacctt
cccacaaaacccggggagtacttcgtgaacattctcttcgaagaagtccacatacctggt
tctcccttcaaagctgacattgaaatgccattcgacccctctaaggttgtggcgtcggga
ccaggtctccagcacgggaaagtgggcgaagccgggctgcttagtgttgactgttccgaa
gctggtcccggggccctggacctggaagccgtctccgactcgggagcgaaagccgaagtc
tgtattgagaacaacaaagacggcacctatgcggtgacctacgtgcccctgaccgccggc
atgtatacgctgaccatgaagtatggcggtgagctcgtgccacacttccccaccagggtc
aaggtggagcctgctgtggacaccagcagggtcaaagtctttgggccaggaatagaagga
aaagacgtgtttcgtgaagccaccactgacttcatgatcgactcacggcccctgacgcag
gtcgggggtgaccacatcaaggcccacattgccaacccctcaggggcctccaccccgtgc
ttcatcacagacaatgccgatggaacctaccaggtggagtacacgccctttgagaaaggc
ctccatgtagtggaggtggcatacgatgatgtgcccatcccaaatagtcccttcaaagtg
gctgtaactgaaggctgccagccatctcgagttcaagcccaaggacctggattgaaagag
gcctttaccaacaaacccaatgtcttcactgtggttaccagaggggcaggaattggtggg
cttggcataactgtggagggaccatcagagtcgaagataaactgcagagacaacaaagat
ggcagctgcagtgctgagtacattccctttgctccaggggattatgatgttaatatcact
tatggaggagcccacatccctggcagccccttcagggttcctgtgaaggatgtcgtggac
cccagcaaggtcaagattgccggccctgggctgggctcaggcgtccgagcccgcatcttg
cagtccttcacggtggacagcagcaaggctggcctggccccactggaagtgagggtcatg
ggcccacgaggcctggtggagccagtgaacatagtggacaacggggatggcacacataca
gtgacctacaccccatcccaggagggaccttacatggtctcagttaaatatgccgatgaa
gagatccctcgtagtccctttaaggtcaaggtccttcccacatatgatgccagcaaagtg
accgccagtggccctggcctcagttcctatggcgtacccgccagtctgcctgtggagttt
gcaatcgatgccagagatgccggggaaggcctgcttgctgttcagataacggaccaagag
ggaaaacccaaaagagccattgtccatgacaataaagatggcacgtatgctgtcacctac
atccctgacaagacgggacgctatatgatcggggtcacttatgggggtgatgagatcccg
ttatctccctaccgcatccgggccacacagacgggtgatgccagcaagtgcctggccaca
ggtcctggaatcgcctccactgtgaaaaccggtgaggaggtgggctttgtggttgatgcc
aagactgctgggaaggggaaagtgacctgcacagttctgaccccagatggcactgaggct
gaggctgatgtcattgagaacgaagatggtacctatgacattttctacacggccgccaag
ccaggcacctatgtaatctacgtgcgctttggtggcgttgatattcccaacagccccttc
acggtcatggccacggatggggaagtcacagccgtggaggaggcaccggtaaatgcatgt
ccccctggattcaggccctgggtaaccgaagaggcctatgtcccagtgagtgacatgaac
ggcctggggtttaaacccttcgacttggtcattccatttgcagtccggaaaggagaaatc
accggagaggtccacatgccttctgggaagacggccacacctgagatcgtggacaacaag
gatggcacggtcactgtgagatatgcccccactgaggtcggactccatgagatgcacatc
aaatacatgggcagccacatccctgagagcccgctgcagttctacgtgaactaccccaac
agtgggagcgtttctgcatacggtccaggcctggtgtatggagtggccaacaaaactgcc
accttcaccatcgtcacagaggatgcaggagaaggtggcctggacttggctattgagggg
ccctcaaaggccgaaatcagctgcattgacaacaaagatgggacatgtacggtgacctac
ctgcccactctgccaggcgactacagcattctggtcaagtacaatgacaagcacatccct
gggagccccttcacagccaagatcacggacgacagccggcggtgctctcaggtgaagttg
ggctctgcagccgacttcctgctcgacatcagcgagactgacctcagcaccctgacagcc
agcattaaggccccatccggccgcgacgagccctgtctcctgaagaggctgcccaacaat
cacatcggcatctccttcatcccccgggaggtaggcgaacacctggtcagcatcaagaag
aacggcaaccacgtggccaacagccccgtgtccatcatggtggtccagtctgagattggt
gatgctcgcagagccaaagtctatgggcgtggcctgtcagaaggccggacttttgagatg
tctgacttcatcgtggacacaagggatgcaggttacggcggcatatccttggcggtggaa
ggccccagcaaggtggacatccagacggaggatctggaagatggcacctgcaaggtttcc
tacttccccactgtgcctggggtttacattgtctctaccaaattcgctgatgagcatgtg
ccagggagcccgtttaccgtgaagatcagtggggaggggagagtcaaggagagcatcacc
cggaccagtcgggccccgtctgtggccactgtcgggagcatctgcgacctgaacctgaaa
atcccagaaatcgacagcagtgacatgtcagcccacgtcaccagcccctctggccgcgtg
accgaggccgagattgtgcccgtggggaagaactctcactgtgtccggttcgtgccccag
gagatgggggttcacacagtcagcgtcaagtaccgtggccagcacgtaaccggcagcccc
ttccagttcactgtggggccgctcggcgaggggggtgcccacaaggtccgggcaggaggc
cccggcctggagagaggagaagcaggagtcccagctgagttcagtatctggacccgggaa
gcaggcgccgggggcctctccatcgctgttgagggccccagtaaggccgagattacattc
gatgaccataaaaatggatcatgcggtgtgtcttacattgcccaggagcctggtaactac
gaggtgtctatcaagttcaacgatgagcacatccctgaaagtccctacctggtacccgtc
atcgcgccctccgacgatgcccgccgcctcactgttatgagccttcaggaatcgggatta
aaagttaaccagccagcctcctttgctataaggttgaatggggcaaaaggcaagattgat
gcaaaggtgcacagcccctcgggagccgtggaggagtgccacgtgtctgagctggagcca
gataaatatgccgttcgcttcatcccccacgagaatggcgtccacatgatcgacgtcaag
ttcaacgggagccacgtggttggaagccctttcaaagtgcgcgtcggggagccaggacaa
gcggggaaccccgccctggtgtccgcctatggcgcaggacttgaggggggcaccacaggt
atccagtctgaatttttcatcaacaccacccgagcagggccagggacattatctgtcacc
attgaaggcccctccaaggttaaaatggattgccaggaaaccccagaagggtacaaagtc
atgtacacccccatggcccctggaaactacctgattggcgtcaaatatggtgggcctaac
cacatcgtgggcagtcctttcaaggccaaggtgacaggccagcgtctggtcagccccggc
tcggccaatgagacctcatccatcctggtggagtcggtgaccaggtcctcgacagagacc
tgctatagtgccatccccaaggcatcctcggacgccagcaaggtgacctccaagggggca
gggctctcgaaggccttcgtgggccagaagagctccttcctggtggactgcagcaaagcc
ggttccaacatgctgctgatcggggtccacgggcccaccaccccctgtgaagaggtctcc
atgaagcatgtgggcaaccagcagtacaacgtcacgtacgtcgtcaaggagagaggggat
tacgttctggccgtgaagtggggagaggaacacatccccggcagccccttccacgtgaca
gtgccttaa

DBGET integrated database retrieval system