KEGG   Equus caballus (horse): 100057973Help
Entry
100057973         CDS       T01058                                 

Gene name
ERLIN2
Definition
(RefSeq) erlin-2
  KO
K23341  erlin
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100057973 (ERLIN2)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    100057973 (ERLIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 RapA_C DUF4346 POR_N
Motif
Other DBs
NCBI-GeneID: 100057973
NCBI-ProteinID: XP_001493841
Ensembl: ENSECAG00000009999
VGNC: 17670
UniProt: F6S8T9
Position
27
AA seq 339 aa AA seqDB search
MAQLGAIVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK
SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI
HHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIR
RNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEK
KISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKD
IPNMFVDSAGGLGKQFEGLADKLGFGLEDEPLEADPEEN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttgggagcaattgtggctgtggctaccagtttcttttgtgcatctctcttc
tcagctgtgcacaagatagaagagggacacattggggtgtattacagaggcggtgccctg
ctgacttccaccagcggccctggtttccatctcatgctccctttcatcacatcatataag
tctgtgcagaccaccctgcagacagacgaggtgaagaacgtaccttgtggaactagtggt
ggtgtgatgatctactttgacagaattgaagtggtgaacttcctggtccccaacgcagtg
tatgacatagtgaagaactatactgccgactacgacaaggccctcatcttcaacaagatc
caccacgagctgaaccagttctgcagtgtacacacgcttcaagaggtctacatcgagctc
tttgatcagattgatgaaaatctcaaactggctttgcaacaggacctgacctccatggcc
cctgggctggtcatccaagccgtgcgggtgaccaagcccaatatacccgaggcaatccgc
agaaactacgagttgatggaaagcgagaagacaaagctgctcattgcagcccagaaacag
aaggtggtggagaaggaagccgagacagagcggaagaaggccctcattgaggcagaaaaa
gtggctcaggttgcagaaatcacctatgggcagaaggtgatggagaaggagactgagaag
aagatttcagaaattgaagatgctgcatttctggcccgggagaaggcgaaggctgatgct
gagtgctacactgctatgaagatagccgaagcaaacaagctgaagctgacccctgagtat
ctgcagctgatgaagtacaaggccattgcttccaacagcaagatttactttggcaaggac
atccctaacatgttcgtggactctgcaggcggtctgggcaagcagtttgaggggctggct
gacaagctgggttttggcttagaagacgagcccttggaggcagaccctgaggagaattga

DBGET integrated database retrieval system