KEGG   Equus caballus (horse): 100058486
Entry
100058486         CDS       T01058                                 

Gene name
MXD3
Definition
(RefSeq) max dimerization protein 3 isoform X1
  KO
K09114  MAX dimerization protein
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100058486 (MXD3)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    100058486 (MXD3)
SSDB
Motif
Pfam: HLH T3SS_needle_E DUF3829 Exonuc_VII_L MSP1_C
Other DBs
NCBI-GeneID: 100058486
NCBI-ProteinID: XP_001502458
Ensembl: ENSECAG00000021155
Position
14
AA seq 372 aa
MGKWAREPARAAPAAPTCSGGVRGLPGTVGPQSSVPCAGPSPQARGWKEAQRRQVTGAGS
LSREGKTQHQPAQGFAQRPGLEPEPVPAPRESEGAGAGRFAEGGLRFPGPYRGGGAQSWA
VPGAGRPGGGAGRLCLLHRVSYIVTKVVQPLLWSAPQARPPPAVADMEPVASNIQVLLQA
AEFLERREREAEHGYASLCPHRSPGPVQRRRKRSPQAPGALDSGRSVHNELEKRRRAQLK
RCLEQLKQQMPLGADCARYTTLSLLRRARMHIQKLEEQEQRARRLKEKLRSKQQSLKQQL
EQLRGLAGPGERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFSTGQ
EHSYSHCGGAWL
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgggcaaatgggctagggagcccgcccgcgccgcccccgcggcgcccacgtgcagcggc
ggagtcaggggcctcccggggaccgtgggcccccaaagcagtgttccttgtgccgggccc
tccccacaagcacggggctggaaagaggcccagagacgccaagtaaccggtgcggggtcg
ctgagcagagagggcaagacgcagcaccaaccagcccaggggttcgcccaaaggccgggc
ctggagccggagcccgtcccagccccgcgggagtccgagggggctggggcgggcaggttc
gcggagggtgggctgcggttcccgggcccataccgggggggcggagctcagagctgggcc
gtcccgggggcggggcgacccgggggcggggccggccgcctgtgtttgttgcaccgtgtc
agttacattgtaacaaaagtggtgcagccgctcctctggtcagcaccccaggcccgcccg
ccgccagctgtcgccgacatggaacccgtggctagcaacatccaggtcctgctgcaggcg
gccgagttcctggagcgccgcgagagagaggccgagcatggctacgcgtccctgtgcccg
caccgcagtccgggccccgtccaaaggaggaggaagcgatccccgcaagctcctggcgct
ctggacagtgggcggtctgtgcacaacgaattggagaagcgcaggagggcccagctgaag
cggtgcctggagcagctgaagcagcagatgcccctgggggctgactgtgcccgatacacc
acactgagcctgttgcgccgggccaggatgcacatccagaaactggaggagcaggagcag
cgagcccggaggctcaaggagaagctgcgcagcaagcagcagagcctgaagcagcagctg
gagcagctccgggggctggcagggccaggcgagcgggagcggctgcgggcggacagcctg
gactcttcaggcctctcctccgagcgctccgactcagaccaagaggagctggaggtggac
gtggagagcctggtgttcgggggtgaggctgagctgctgcggggcttcagcaccggccag
gagcacagctactcacactgcggcggtgcctggctatga

DBGET integrated database retrieval system