KEGG   Equus caballus (horse): 100058510Help
Entry
100058510         CDS       T01058                                 

Gene name
CAMKK2
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 2 isoform X1
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04140  Autophagy - animal
ecb04152  AMPK signaling pathway
ecb04211  Longevity regulating pathway
ecb04920  Adipocytokine signaling pathway
ecb04921  Oxytocin signaling pathway
ecb05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100058510 (CAMKK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100058510 (CAMKK2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100058510 (CAMKK2)
   04921 Oxytocin signaling pathway
    100058510 (CAMKK2)
  09149 Aging
   04211 Longevity regulating pathway
    100058510 (CAMKK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    100058510 (CAMKK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100058510 (CAMKK2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100058510 (CAMKK2)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: Other
  CAMKK family
   100058510 (CAMKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 100058510
NCBI-ProteinID: XP_023502948
Position
8
AA seq 578 aa AA seqDB search
MSSCVSSQLSSDRAAPQDELGGGGGSSSEGQKPCEALRGLSSLSIRLGMESFIVVTECEP
GCAVDRGLARDRPLEADGREVPLDASGSQSRPHFSGRKLSLQERSQLDANGRCVHPGLPP
SPVGSPQLSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDN
TYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNV
VKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKI
IHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSG
KALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLD
KNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVK
TMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECEPLSEPKEARQRRQPPGPRPAPR
GGGGSALVKGGPRVESWGAPAPGSRARMPPLRPDEAMD
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatgcgtctctagccagctgagcagcgaccgggccgccccccaggatgagctg
gggggcgggggcggcagcagcagcgaaggccagaagccctgtgaagccctgcggggcctc
tcgtccctgagcatccgcctgggcatggagtccttcatcgtggtcaccgagtgtgagccg
ggctgtgctgtggaccgtggcttggcccgggaccggccactggaggctgatggccgagag
gtccccctcgatgcctccgggtcccagtcccggccccacttctccggtcgcaagctctcc
ctgcaggagcggtcccagctggacgcgaacggccgctgcgtgcacccgggcctgcccccg
tcacccgtcggctccccgcagttgtccccgcggctgccccggcggcccacggtggagtcc
caccacgtctccatcaccggcatgcaggattgtgtacagctgaaccagtacacactgaag
gatgaaattggaaagggctcctatggcgtggtcaagttggcctacaatgaaaatgacaat
acctactatgcgatgaaggtgctgtccaaaaagaagctgataagacaggcgggctttcca
cgtcgccctccaccccgaggcacccggccagccccagggggctgcatccagcccaggggc
cccattgagcaggtataccaggaaatcgccatcctcaagaagttggaccaccccaacgtg
gtgaagctggtggaggtcctggatgaccccaatgaggaccatctgtacatggtgtttgaa
ctggtcaaccaagggcctgtgatggaggtgcccaccctcaaaccgctgtctgaggaccag
gcccgtttctacttccaggatctgatcaaaggcatcgagtacttgcactaccagaagatc
atccaccgagacatcaaaccttccaacctgctggttggagaagatgggcacatcaagatt
gccgactttggtgtgagcaatgagttcaagggcagcgacgcgctcctctctaacactgtg
ggcacgcccgccttcatggcacccgagtcgctctcggagacccgcaagatcttctctggg
aaggccttggatgtttgggccatgggtgtgacgctgtactgctttgtgtttggccagtgc
ccgttcatggacgagcggatcatgtgtttacacagtaagatcaagagtcaggccctggaa
tttccagatcagcccgacatagctgaggacttgaaggacttgatcacccgcatgttggac
aagaaccctgagtccaggattgtggtgccggagatcaagctgcacccctgggtcacgagg
cacggggcggagccgttgccatcggaggacgagaactgcacgctggtcgaagtgactgaa
gaggaggtcgagaattcggtcaaacacattcccagcctggcaaccgtgatcctggtgaag
accatgatacgaaaacgctcctttgggaacccgtttgagggcagccggcgggaggagcgc
tcgttgtcagcacctgggaacctgctcaccaaaaaaccaaccagggaatgtgagcccctg
tctgagcccaaggaagcaaggcagcgaagacagcctccggggccccgacccgccccccgt
gggggaggaggaagtgctcttgtgaaaggcggtccccgcgtggagagctggggggccccg
gccccgggctcccgcgcacgcatgcctcctctgcggcccgacgaggcgatggactag

DBGET integrated database retrieval system