KEGG   Equus caballus (horse): 100058875Help
Entry
100058875         CDS       T01058                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1 isoform X2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00600  Sphingolipid metabolism
ecb01100  Metabolic pathways
ecb04020  Calcium signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04370  VEGF signaling pathway
ecb04371  Apelin signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb05152  Tuberculosis
Module
ecb_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100058875 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100058875 (SPHK1)
   04371 Apelin signaling pathway
    100058875 (SPHK1)
   04020 Calcium signaling pathway
    100058875 (SPHK1)
   04072 Phospholipase D signaling pathway
    100058875 (SPHK1)
   04071 Sphingolipid signaling pathway
    100058875 (SPHK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100058875 (SPHK1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100058875 (SPHK1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100058875 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 100058875
NCBI-ProteinID: XP_001491739
Position
11
AA seq 475 aa AA seqDB search
MSARVLGFLCNWTPLLLAAPGGLRNPAAAGNDADAPTAPASGGEGEPHSQHRDARLGSID
KELKAGDAGAGSAPTALGTPWQREPRVEVMDPARGTQRQLPRPCHVLVLLNPCGGKGKAL
ELFRSHVQPLLAQEDVSFKLLLTERRNHARELVRAEELGHWDALVVMSGDGLMHEVVNGL
MERPDWETAIQKPLCSLPAGSGNALAASVNHYAGFEQVTDEDLLTNCTLLLCRRLLAPMN
LLSLQTASGLRLFSVLSLAWGFIADVDLESEKFRCLGEVRFTLGTFLRLAALRIYRGQLA
YLPVERVVSKMPTSPALDRQNQQGPVDAHLVPLEEPVPSHWTVVPEQDFVLVLVLLHSHL
GSEMFAAPMGRCEAGTMHLFYIRAGVSRAMLLRIFLAMQNGRHMEYDCPYLVYVPVVAFR
LEPKDGKGVITVDGELMASEAVQGQVHPNYFWMVSGCMEPPPSLEPQPSPSRKPK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctagagttctgggatttttatgcaactggactcccctcctcctggcagccccc
ggggggctgaggaatccagcagctgcagggaatgacgcggatgcccctactgccccggct
tcaggcggggagggcgagccccacagccagcaccgtgacgcccgcctgggcagcatcgat
aaggaactgaaggcaggagacgccggcgcgggcagcgccccgacagcgctggggaccccc
tggcagcgggagccgcgggtcgaggttatggatccagcgaggggaacccagcgccagctc
ccacggccctgccacgtgctggtgctgctgaacccgtgcgggggcaagggcaaggccctg
gagctcttccggagccacgtgcagcccctgctggcccaggaggatgtctccttcaagctg
ttgctcactgagcggcggaaccacgcccgcgagctggttcgggcagaggagctgggacac
tgggacgcgctggtggtcatgtctggagatgggttgatgcatgaggtggtgaacgggctc
atggagcggcctgactgggagaccgccatccagaagcccctgtgcagcctcccagctggc
tctggcaatgctctggcagcttctgtgaaccattatgccggctttgagcaggtgactgat
gaagacctgctgaccaactgcacgctgctgctgtgccgccggctgttggcgcccatgaac
ctgctgtcactgcaaacagcctccgggctgcgtctcttctccgtgctcagcctggcgtgg
ggcttcattgctgatgtggatctggagagtgagaagtttcggtgcctgggggaggtgcgc
ttcactctgggcaccttcctgcgcctggcagccctacgcatctacaggggccaactggcc
tacctccccgtagaaagggtggtctccaagatgcccacctccccggctctggaccggcag
aaccagcagggccctgtggatgcccaccttgtgcccttggaggagccagtgccctcccac
tggaccgtggtgccagagcaggactttgtgctggtgctggtgctgctgcactcacatctg
ggcagcgagatgtttgctgcacccatgggccgctgtgaggccggcactatgcacctgttc
tacatacgggcaggtgtgtctcgggccatgctgctgcgcatcttcctggccatgcagaac
ggcaggcacatggagtatgactgtccctacttggtgtatgtgcctgtggttgccttccgc
ctggagccaaaggatggtaagggtgtgattactgtggacggggagttgatggccagtgag
gctgtgcagggccaggtgcacccaaactacttctggatggtcagtggctgcatggagccc
ccaccctctctggagccacaaccctcgcccagccgtaagcccaagtag

DBGET integrated database retrieval system