KEGG   Equus caballus (horse): 100059530
Entry
100059530         CDS       T01058                                 

Gene name
SAP30BP
Definition
(RefSeq) SAP30-binding protein isoform X1
Organism
ecb  Equus caballus (horse)
SSDB
Motif
Pfam: HCNGP LRRFIP Med3
Other DBs
NCBI-GeneID: 100059530
NCBI-ProteinID: XP_001495485
Ensembl: ENSECAG00000025125
VGNC: 22687
UniProt: F6Q4G0
Position
11
AA seq 308 aa
MAGKKSVLSSLAVYAEDSEPESDGEAGVETAGSAAEEKGGLVSDAYGDDDFSRLGGDEDG
YEEEEDENSKQSEDDDSETEKPEADDPKDNPEVEKRDPQELVASFSERVRNMSPDEIKIP
PEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTN
YPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATATTT
TTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVG
TIVKKAKQ
NT seq 927 nt   +upstreamnt  +downstreamnt
atggcggggaagaagagtgttctgtcgtctctggcagtttacgcggaagattcagagccc
gagtccgacggcgaggctggagtcgaaacggcgggcagcgcggctgaggagaaaggtgga
ttggtatctgacgcctatggagacgatgacttttctcgcctcgggggtgatgaagatggt
tatgaagaagaggaggatgagaacagcaaacagtcggaagatgacgattcagagactgaa
aaacctgaggctgatgacccaaaggataatccagaagtagaaaagcgagacccccaggaa
ttggtcgcctccttttctgaaagagtccggaacatgtcgcctgatgaaatcaagattccg
cctgaaccccctggcagatgttcaaatcacctacaagacaagatccagaagctttatgag
cggaagataaaggagggaatggatatgaactatattatccaaaggaagaaagagtttcgg
aaccccagcatctatgagaagctgatccagttctgtgcaattgatgagctcggcacaaac
tacccaaaggatatgtttgacccccatggctggtccgaggactcctactatgaggcatta
gccaaagcccagaagattgaaatggacaaactggaaaaggccaaaaaggagcgaaccaaa
attgagtttgtgacgggcaccaagaaaggcaccacaaccaacgccacagccaccaccacc
accacggccagcacagctgttgcagatgcccaaaagagaaagagcaaatgggactcggcc
atcccggtgacaacgatagctcagcccaccattcttaccaccacggcaaccttgccagct
gtcgtcacagtgaccaccagtgccagtggctccaagaccactgttatctctgctgtgggc
accattgtgaagaaggccaagcagtga

DBGET integrated database retrieval system