KEGG   Equus caballus (horse): 100059819Help
Entry
100059819         CDS       T01058                                 

Gene name
DAO
Definition
(RefSeq) D-amino-acid oxidase isoform X2
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00260  Glycine, serine and threonine metabolism
ecb00330  Arginine and proline metabolism
ecb00472  D-Arginine and D-ornithine metabolism
ecb01100  Metabolic pathways
ecb04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100059819 (DAO)
   00330 Arginine and proline metabolism
    100059819 (DAO)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    100059819 (DAO)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    100059819 (DAO)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100059819 (DAO)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     100059819 (DAO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO Pyr_redox Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 100059819
NCBI-ProteinID: XP_001500986
Ensembl: ENSECAG00000008398
VGNC: 17004
UniProt: F6TGC3
Position
8
AA seq 347 aa AA seqDB search
MRVVVIGAGVIGLSTALCIHDRYQPVLQSLDVRVYADRFTPLTNTDVAAGLWQPYLSNPS
NPQETHWNQQTFDYLLSHLHSPNAADMGLALISGYNLFHEAVPDPSWKDIVLGFRKLTPR
ELDMFPDYSYGWFNTSLILEGKRYLQWLTERLTERGVKFSQRKVESLEEVARGGADVIIN
CTGVRAGELQPDPMLQPGRGQIIKVDAPWMKHFIVTHDPERGIYRSPYIIPGIREVTLGG
IFQLGNWSEVNNIQDHKSIWEGCCRLEPTLKKAEIVSECTGFRPVRPQVRLERERLRFGP
SNTELIHNYGHGGYGLTIHWGCALEAAKLFGEVLEERKLLRMPPSHL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtagtggtgatcggagcaggggtcattgggctgtccacagccctctgcatccac
gaccgctaccagccagtgctgcagtcgctggatgtgagggtctacgcagaccgcttcacc
ccgctcaccaacaccgacgtggctgccggcctctggcagccctacctctccaaccccagc
aacccgcaggagacgcattggaaccagcagacctttgactatctcctgagccacctccat
tctcccaacgctgcagacatgggcctggccctgatctcaggctacaacctcttccatgaa
gctgttccggacccttcctggaaggacatagttctgggatttcggaagctgacccccaga
gagctggacatgttccctgattatagctatggctggttcaacacgagcctgatcctggag
ggcaagcggtatctgcagtggctgactgagaggttaactgagcggggagtgaaattctcc
cagaggaaggtggagtctttggaggaggtggcaagaggaggcgcagacgtgattatcaac
tgcaccggggtgcgggccggggagctgcaaccagaccccatgctgcagcccggccggggg
cagatcattaaggtggatgccccctggatgaagcacttcattgtcacccacgacccagag
agaggcatctacaggtccccatacatcatcccagggatccgggaagtgactcttggaggc
atcttccagctggggaactggagtgaagtaaacaatatccaggaccacaagagcatttgg
gaaggctgctgcagactggagcccacactgaagaaggcagaaattgttagtgaatgcact
ggcttccgaccagtacgcccccaggttcggctagagagagaacggcttcgctttggaccg
tccaacacagagctcatccacaactatggccatggaggctatgggctcaccatccactgg
ggctgtgccctggaggcagccaagctctttggggaagtcctggaagaaaggaagttgctc
aggatgccaccatcccacctctga

DBGET integrated database retrieval system