KEGG   Equus caballus (horse): 100060148
Entry
100060148         CDS       T01058                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100060148 (ANKRD53)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100060148 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_3 Ank_4
Other DBs
NCBI-GeneID: 100060148
NCBI-ProteinID: XP_005599964
VGNC: 51275
Position
15
AA seq 578 aa
MQPAEKVSKVSRSDSESRQPRWAGIRWPGCGAGETRSAPPGSAGPGAARGAQGSRLGPGS
PPERCPGPSTMVASSSPRQPGGLASVSTNAPGRECRPRPHGAPSQAAQPGPASSSSSSPH
PSPLPSPLPHSDSSPVDERDQRAIGRDSELFAAALGNLEWLRFCLNRDRGEILANDKGFT
AIHFAAQSCKLACLQVLVEEYKFPVNLPTNNGQTPLHLVMHRDNKTMALPCIHYLLKQGA
ALNTRTCNGSTPLHLAAREGLLNCVEVLVQNGANVHAQDAMGCKPIDYCKVWNHRICARF
LKDAMWKWDKKNFAREMGKLKRLKDQLALMEQDYLTDYQKEHKSLREADFKKWLHGKRLP
GGQSLMGNSEQEPCAPPQAVAVSKTPRHRGLWPPKSFHPSPEARLQQTLQLKPPPLVMPK
PIYMRPMVRRPKLWNLSNNPARSPTIQIGYPQGIRLGVHPDPWPEHDFSSFLRVRSNGHG
GVSLCTVTGKLVSPVPRLPFEVIVRGLYPSVQPYRMKVPQDLYSVSMRDVPRKRHLGDDT
FWTDSLAMNLRETFDEAFLAAVRAHQGLLTLSSPKTHP
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgcagccggcggagaaggtctcgaaggtctcccggagtgactcggaatcaaggcagccg
aggtgggccgggattaggtggcccggctgcggggcgggagaaacccgctcagcgcctccc
gggagcgcagggcctggagcggcccgaggagcccagggatcccggctggggccgggctcg
cctcctgagaggtgcccggggccctcgacgatggtcgcctcctcgtcgccccgccaacca
ggcggccttgcctcggtctccacgaacgccccggggcgcgagtgccgccctcgcccacac
ggcgccccttcacaggccgcccagccgggaccagcctcttcctcgtccagttccccgcat
ccttccccgcttccctccccactaccccacagcgactctagtcccgtcgatgagcgggac
cagagggcgattgggagagactccgagctgttcgcggccgcgctgggcaacctggaatgg
ttgcggttctgtctgaatcgggaccgtggagaaatcctggccaatgacaagggtttcact
gccatccactttgcagcccagagctgcaagctggcatgcctgcaggtcttggtagaggag
tacaagtttccagtaaacctgcccaccaacaatggccagacccctctgcacctcgtcatg
cacagggacaacaagaccatggccctcccctgcattcactacctgcttaagcaaggcgcg
gccctcaacactcggacgtgcaatggctccacgcccctgcacctggcagcccgtgaaggc
ctgctgaactgtgtggaggtcctagtgcaaaatggcgccaatgtccatgcccaggatgcc
atgggctgcaagcccatcgactattgcaaagtatggaaccaccgcatctgtgcccgcttc
ttgaaggatgccatgtggaaatgggacaagaagaactttgctcgtgagatggggaaactg
aagaggctcaaggaccagctggccctcatggagcaggactacctgactgactatcaaaaa
gagcacaaaagtctgagagaggctgatttcaagaagtggcttcatggcaagcggctgccc
ggaggccaatccctgatgggcaactctgagcaagagccttgtgccccaccccaggccgtt
gccgtctccaagacgcccaggcacaggggattgtggcctcccaaaagcttccacccctcg
ccggaggcgcgcctgcaacagactctgcagctcaagccgccgcccttggtgatgcccaag
cccatctacatgcggcccatggtcaggaggcccaagttgtggaaccttagcaacaacccc
gccagatcccccaccatccagatcggctacccacagggcatccgcctgggagtgcatcca
gacccctggccagagcacgacttcagcagcttcctcagggtgaggtccaacgggcacggt
ggtgtgagcctatgcacagtgaccggcaagctggtgtcgcctgtgccccggctgcctttt
gaggtgatagtccgcgggctgtacccttcggtgcagccatacaggatgaaggtgccccag
gacctttactccgtcagcatgagggacgtgcccaggaagcggcacttgggcgacgacacc
ttctggactgatagtctggccatgaacctgcgtgagacgtttgatgaagccttcctggca
gctgtgcgagcccatcaagggctcctcactctgtcctcccctaaaacccacccataa

DBGET integrated database retrieval system