KEGG   Equus caballus (horse): 100060371Help
Entry
100060371         CDS       T01058                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
ecb  Equus caballus (horse)
Pathway
ecb03320  PPAR signaling pathway
ecb04659  Th17 cell differentiation
ecb04919  Thyroid hormone signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05216  Thyroid cancer
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    100060371 (RXRG)
  Endocrine system
   04920 Adipocytokine signaling pathway
    100060371 (RXRG)
   03320 PPAR signaling pathway
    100060371 (RXRG)
   04919 Thyroid hormone signaling pathway
    100060371 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    100060371 (RXRG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100060371 (RXRG)
   05202 Transcriptional misregulation in cancers
    100060371 (RXRG)
   05226 Gastric cancer
    100060371 (RXRG)
   05216 Thyroid cancer
    100060371 (RXRG)
   05222 Small cell lung cancer
    100060371 (RXRG)
   05223 Non-small cell lung cancer
    100060371 (RXRG)
Transcription factors [BR:ecb03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100060371 (RXRG)
Nuclear receptors [BR:ecb03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100060371 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 100060371
NCBI-ProteinID: XP_023496573
Ensembl: ENSECAG00000024377
VGNC: 22641
Position
5
AA seq 463 aa AA seqDB search
MYGNYSHFMKFPTGFGGSPGHSGSTSMSPSAALSTGKPMDSHSSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGTLAAPPGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIP
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatggcaattattctcacttcatgaagtttcccacaggctttggcggctcccccggc
cactctggctccacgtccatgagcccatcggcagccttgtccacagggaaaccaatggac
agccactccagctacacggacaccccagtgagtgccccacggactctgagtgcagtgggg
accccccttaatgccctgggttctccatatcgagtcatcacttctgccatgggcccaccc
tcaggaacgctggcagcccctccgggaatcaatttggttgctccacccagctctcagcta
aatgtggtcaacagtgtcagcatttcagaggacatcaagcctttgccagggcttcctggg
attggaaacatgaactacccgtccaccagccctggatctctggttaaacacatctgtgcc
atctgtggggacagatcctcaggaaagcactatggtgtgtacagctgtgaaggctgcaaa
gggttcttcaagagaaccataaggaaagacctcatctacacgtgtcgggataataaagac
tgcctcattgacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagaaaggcagaggagccgtgagcgtgcc
gagagtgaggcggaatgtgccagtagtggccatgaagatatgccggtggagaggattcta
gaagctgaacttgctgttgaaccaaagacggaatcctatggtgacatgaacatggagaac
tcaacgaatgaccccgtcaccaacatatgccatgctgctgataagcagcttttcactctc
gttgaatgggccaagcgcattccccacttctctgacctcaccttggaggaccaggtcatt
ctgctccgggcagggtggaatgaattgctgattgcctccttctcccaccgctcagtttcc
gtgcaggatggcatccttctggccacgggtttacacgtccacaggagcagtgcccacagt
gctggggttggctccatctttgacagagttctgactgagctggtctccaaaatgaaagac
atgcagatggataagtctgagctggggtgtctgcgagccatcgtgctgtttaacccagat
gccaagggtctgtccaacccctctgaggtagagactctgcgagagaaggtttatgccacc
ctcgaggcctacaccaagcagaagtatccggaacaaccaggcaggtttgccaagctgctg
ctgcgcctcccagccctgcgctccatcggcttgaagtgcctggagcatctcttcttcttc
aagctcatcggggacacgcccatcgacaccttcctcatggagatgttggagaccccgctg
cagatcccctga

DBGET integrated database retrieval system