KEGG   Equus caballus (horse): 100060521
Entry
100060521         CDS       T01058                                 

Name
(RefSeq) neuronal acetylcholine receptor subunit alpha-7 isoform X2
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
ecb  Equus caballus (horse)
Pathway
ecb04020  Calcium signaling pathway
ecb04080  Neuroactive ligand-receptor interaction
ecb04725  Cholinergic synapse
ecb05010  Alzheimer disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05033  Nicotine addiction
ecb05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100060521
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100060521
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100060521
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100060521
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100060521
   05022 Pathways of neurodegeneration - multiple diseases
    100060521
  09165 Substance dependence
   05033 Nicotine addiction
    100060521
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ecb04040]
    100060521
Ion channels [BR:ecb04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100060521
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD SUR7
Other DBs
NCBI-GeneID: 100060521
NCBI-ProteinID: XP_014589578
Ensembl: ENSECAG00000024757
Position
1:110069426..110178010
AA seq 423 aa
MSWTDHYLQWNMSEYPGVTNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQ
YLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISSYIPNGEWDLV
GIPGKRSEKFYECCKEPYPDVTFTVTIRRRTLYYGLNLLIPCVLISALALLVFLLPADSG
EKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAKYFASTMIIVGLSVVVTVIVLQYHH
HDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAGPPA
TNGNLLYIGFRGLEGVHCAPTPDSGVVCGRMACSPTHDEHLLHGGQPSEGDPDLAKILEE
VRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFCIFTIICTIGILMSAPNFVEAVSK
DFA
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgtcttggacagatcactatttacagtggaatatgtcagagtatccgggtgtgacgaat
gttcgtttcccagatggccagatttggaagccagacattcttctctataacagtgctgat
gagcgatttgatgccacattccacaccaacgtgttagtgaattcttctgggcattgccag
tacctccctccaggcatattcaagagctcctgctacattgacgtgcgctggttccccttt
gatgtgcagcactgcaaactgaagtttgggtcctggtcttacggagggtggtccttggat
ctacagatgcaggaagcggatatcagcagctatatcccaaatggagaatgggaccttgtg
ggaatccccggtaagagaagtgagaagttctatgagtgctgcaaagagccatacccggac
gtcaccttcacagtgaccattcgccgcaggactctctactacggcctcaacctgctcatc
ccttgtgtgctcatctcagcccttgccctcctcgtcttcttgctccctgcagactctgga
gagaaaatctcgcttggaataacagttttactgtctcttactgtcttcatgctgctggtg
gctgagatcatgcctgcaacatctgattcagtgcccttgatagccaagtacttcgccagc
accatgatcatcgttggcctctctgtggtcgtcacagtgattgtgctgcagtaccaccac
cacgaccccgatggcggcaagatgcccaagtggaccagagtcatccttttgaactggtgt
gcgtggttcctgcgcatgaagaggccaggggaggacaaggtgcgtcccgcctgccagcac
aagcagcgccgctgcagcctggctagcgtggagatgagcgcggtggctgggccgccggcc
accaatggcaacctgctctacattggcttccgaggtctagaaggagtgcactgcgccccc
acccccgactccggagttgtgtgcggccgcatggcctgctcacccacgcatgacgagcac
ctgctgcatggcgggcagccgtccgagggagacccggacctggccaagatcctggaggag
gtccgctacatcgccaaccgcttccgctgccaggacgagagtgaggccgtctgcagcgag
tggaagttcgcggcctgcgtggtggaccgtctgtgcctcatggccttctgcatcttcacc
atcatctgcaccattggcatcctgatgtcggctccaaacttcgtcgaggctgtgtccaag
gacttcgcttaa

DBGET integrated database retrieval system