KEGG   Equus caballus (horse): 100060993
Entry
100060993         CDS       T01058                                 

Gene name
HGD
Definition
(RefSeq) homogentisate 1,2-dioxygenase
  KO
K00451  homogentisate 1,2-dioxygenase [EC:1.13.11.5]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00350  Tyrosine metabolism
ecb01100  Metabolic pathways
Module
ecb_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100060993 (HGD)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.5  homogentisate 1,2-dioxygenase
     100060993 (HGD)
SSDB
Motif
Pfam: HgmA
Other DBs
NCBI-GeneID: 100060993
NCBI-ProteinID: XP_001502449
Ensembl: ENSECAG00000023083
VGNC: 18768
UniProt: F6U5B3
Position
19
AA seq 445 aa
MAELKYISGFGNECASEDPRCPGALPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSW
LYRILPSVSHKPFESTDQGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKADFVSGLHTLC
GAGDIRSNNGLAIHIFLCNVSMEDRCFCNSDGDFLIVPQKGKLLIYTEFGKMLVQPNEIC
VIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPVAWYEDRQVP
GGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLENFMVINSVAFDHADPSIFTV
LTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIKGHYEAKEGGFLPG
GGSLHSSMTPHGPDADCFEKASRAKLAPERVADGTMAFMFESSLSMAVTKWGLKTSNCLD
ENYYKCWEPLKSHFTPNSRNPAGRI
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggccgagttgaagtacatttctggatttgggaatgaatgtgcctcagaggaccctcgc
tgcccaggtgccctgccagaaggacagaataatcctcaagtctgcccctacaatctgtat
gctgagcagctctcaggatcggctttcacttgtccaaggagcaccaataagagaagctgg
ctgtataggattctaccttcagtttctcacaagccctttgaatccactgaccaaggccat
gtcactcacaactgggatgaagttgatcctgatcccaaccagcttagatggaaaccattt
gagattccaaaagcatctcagaagaaagcggacttcgtgagtggcctgcataccttgtgt
ggtgctggggacatcaggtctaacaatgggcttgccatccacattttcctctgcaacgtc
tccatggaggatagatgtttttgcaattcagatggggacttcttgattgttcctcaaaaa
gggaaacttctcatttacactgagtttggcaagatgcttgtgcagcccaacgagatctgc
gtcattcagagaggaatgcggttcagcatagatgtcttcgaggagaccaggggctacatc
ctggaggtctatggcgtccactttgagttgcctgacctgggaccaattggagccaatggc
ttggccaatcctcgtgatttcttgatacctgttgcctggtatgaagatcgccaagtgcca
ggtggctacactgtgattaacaaataccagggaaagctatttgctgctaaacaggatgtc
tccccgttcaatgttgtggcctggcacgggaactatacaccctacaagtacaacttggag
aacttcatggtcatcaactcagtggcttttgaccacgcggacccatccattttcacagta
ttgactgccaagtctgtccgccctggagtggccatcgctgattttgtcatcttcccacct
cgatggggggttgctgacaagaccttcaggcctccttattaccataggaactgcatgagt
gaattcatgggactcatcaaaggtcactacgaggcaaaggaaggtgggttcctgccaggg
ggaggcagcctgcacagctcaatgaccccccacgggcctgatgctgactgctttgagaag
gccagcagagccaagctggcaccggagagggttgctgatggcaccatggcatttatgttt
gagtcatctctaagtatggccgtcaccaagtgggggctcaagacctctaactgtttggac
gagaactactacaagtgctgggaacctctcaagagccacttcacccccaattccaggaat
ccagcaggacgtatttga

DBGET integrated database retrieval system