KEGG   Equus caballus (horse): 100061061Help
Entry
100061061         CDS       T01058                                 

Gene name
CPT2
Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial isoform X1
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00071  Fatty acid degradation
ecb01212  Fatty acid metabolism
ecb03320  PPAR signaling pathway
ecb04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100061061 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100061061 (CPT2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100061061 (CPT2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100061061 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf Tri3
Motif
Other DBs
NCBI-GeneID: 100061061
NCBI-ProteinID: XP_001489700
Ensembl: ENSECAG00000022130
VGNC: 16842
UniProt: F6XKH9
Position
2
AA seq 658 aa AA seqDB search
MVTRLLLRPWARGPAVGPAAPCRPLSAGSRPSQYLQRSLVPTMHYQDSLPRLPIPKLEDT
IRRYLNAQKPLLDDSQFRKTEQLCKSFESGIGKELHEQLVAQDKQNKHTSYISGPWFDMY
LTARDSIVLNFNPFMAFNPDPKSEYNDQLTRATNLTVSAVRFLKTLRAGLLEPEVFHLNP
AKSDTDTFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPRPSRDELFTDDKA
RHLLVLRKGHFYVFDVLDQDGNIVSPSEIQAHLKYILSDSSPAPEFPLAYLTSENRDVWA
ELRQKLVNGGNEETLRKVDSAVFCLCLDDFPIKDLIHLSHSMLHGDGTNRWFDKSFNLVI
AEDGTAGVHFEHAWGDGVAVLRFFHEVFKDSTQAPAITPQSQPAKTDSSIAVQKLSFKLS
DALKTGISAAKDKFDATVTTLTIDIIRFQRGGKEFLKKQKLSPDSVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASVFTKRCSEAFVREPSKHSAAELQQMMAECSKYHG
RLTKEAAMGQGFDRHLFVLRYLAAAKGISVPELFLDPAYGQMNHNVLSTSTLSSPEVSLG
GFAPVVPDGFGVGYAVHDDWIGCNVSSYPGRNSQEFLQCVEKALEDMFDALEGKAIKT
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggtgacccgcctgctgctgcgcccctgggcccgcggtccggcggtgggcccggcagcc
ccgtgtcggcccctcagcgccggctccaggcccagccagtacctgcagcgcagcctggtg
cccaccatgcactaccaggacagcctgcccaggcttcctattcccaaacttgaagacacc
attaggagatacctcaatgcgcagaagcctctcttggatgacagccagttcaggaaaaca
gaacagctttgcaagagttttgaaagtgggattggaaaagagctgcacgagcagctggtt
gctcaggacaagcagaataaacacacgagctacatttcaggcccctggtttgatatgtac
ttaactgcgcgagactccattgtcttgaactttaatccatttatggcattcaatcctgac
ccaaagtctgagtataatgaccagctcacccgggcgaccaacctgactgtttctgccgtc
cggttcctgaagacactgagggctggccttttggagccagaagtgttccacttgaaccct
gccaaaagtgacactgataccttcaagagactcatacgctttgtgccttcctctctgtcc
tggtatggtgcctacttggtcaatgcgtatcccctggatatgtcccagtattttcggctt
ttcaattcaactcgtttacccagacccagtcgggatgaactcttcactgatgacaaggcc
agacacctcctggttctaagaaaaggacatttctatgtctttgatgtcctggatcaagat
gggaacattgtgagcccctccgaaatccaagctcatctgaagtacattctctcagacagc
agccccgcccctgagtttccactggcgtatctgaccagtgagaaccgagacgtgtgggca
gagctcaggcagaagctggtgaatgggggcaacgaggagaccctgaggaaggtggactct
gctgtgttctgtctctgcctagatgacttccccatcaaggacctaatccacttgtcccac
agcatgcttcacggtgatggcaccaaccgctggtttgataaatcgtttaacctcgtgata
gctgaggacggcactgctggcgtccactttgaacatgcttggggcgacggtgtggcagtg
ctcaggttctttcatgaagtgtttaaagacagcactcaggcccccgccatcactccacag
agccagccggccaagactgactcctctattgccgtgcagaaactcagcttcaagctgagt
gatgccttgaagactggcatcagtgctgctaaggacaagtttgatgccaccgtgacaacc
ctcaccatcgacatcatccggtttcagagaggaggcaaagaattcctgaagaagcagaag
ctgagccctgactcggtggcccagctggccttccagatggcctttctgaggcagtacggg
cagaccgtggccacctacgagtcctgtagcacagcagcattcaagcacggccgcaccgag
accatccgcccggcctccgtcttcacaaagaggtgctctgaggcctttgtcagggagccc
tccaagcacagtgctgcggagcttcagcagatgatggccgagtgctccaagtaccacggc
cggctgaccaaagaggcagcaatgggccagggctttgaccgccacttgtttgttctgcgg
tacttggcagcagccaaagggatttccgtgcctgagctgttcctggaccctgcatacggg
cagatgaaccacaacgtcctgtctacgagcacgctgagcagcccagaagtgagcctcggc
ggctttgcccccgtggtccccgatggctttggcgttgggtatgctgttcacgacgattgg
ataggctgcaacgtctcctcctacccaggccgcaacagccaggagtttctccagtgtgtg
gagaaggccttggaagacatgtttgatgccttagaaggcaaagccatcaaaacttaa

DBGET integrated database retrieval system