KEGG   Equus caballus (horse): 100061078Help
Entry
100061078         CDS       T01058                                 

Gene name
GPX6
Definition
(RefSeq) glutathione peroxidase 6 precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00480  Glutathione metabolism
ecb00590  Arachidonic acid metabolism
ecb04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100061078 (GPX6)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100061078 (GPX6)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    100061078 (GPX6)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100061078 (GPX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 100061078
NCBI-ProteinID: NP_001159955
Position
20
AA seq 221 aa AA seqDB search
MIRQLWASSLFPLFLVGFAQLTPESQKMKMDCYKGVTGTIYEYGALTLNGEEYIQFKQYA
GKHVLFINVATYUGLTAQYPELNALQEELKPFGVVLLGFPCNQFGKQEPGKNSEILSGLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSPKQLFWEPMKVHDIR
WNFEKFLVGPDGVPVMRWFHRASVSTVKSDILEYLKQFTPE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatccggcagctctgggcctcctctcttttcccgctgttcctggtgggcttcgctcag
ctaaccccggagtcacagaagatgaagatggattgttataagggggtgacaggcaccatc
tatgagtatggagccctcactctcaatggcgaggagtatatccagttcaagcagtatgcg
ggcaagcacgtcctctttatcaatgtggccacctattgaggtttgacagctcagtatcct
gaactgaatgcactacaggaggagctgaagccttttggtgtagttttgttgggctttccc
tgcaaccagtttggcaaacaagaaccaggaaaaaactcagagatcctttctgggctcaag
tatgtgcgtccaggtggtggctttgtccccaattttcagctctttgagaaaggggatgtg
aatggagaaaaagaacagaaagtctttaccttcctgaagaactcctgccctccaacctct
gatcttttgggctcaccaaaacaactcttctgggagcccatgaaggtccacgacatccgc
tggaactttgagaaattcctggtgggacctgatggagtccctgtcatgcgctggttccat
cgggcctcagtcagcacagtcaagtcagacatcctggagtacctgaagcagttcacacct
gagtag

DBGET integrated database retrieval system