KEGG   Equus caballus (horse): 100061542Help
Entry
100061542         CDS       T01058                                 

Definition
(RefSeq) cytochrome P450 2C19 isoform X1
  KO
K17721  cytochrome P450 family 2 subfamily C polypeptide 19 [EC:1.14.14.51 1.14.14.52 1.14.14.53 1.14.14.75 1.14.14.-]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00590  Arachidonic acid metabolism
ecb00591  Linoleic acid metabolism
ecb00982  Drug metabolism - cytochrome P450
ecb01100  Metabolic pathways
ecb04726  Serotonergic synapse
ecb05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100061542
   00591 Linoleic acid metabolism
    100061542
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100061542
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100061542
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100061542
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ecb00199]
    100061542
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.51  (S)-limonene 6-monooxygenase
     100061542
    1.14.14.52  (S)-limonene 7-monooxygenase
     100061542
    1.14.14.53  (R)-limonene 6-monooxygenase
     100061542
    1.14.14.75  fenbendazole monooxygenase (4'-hydroxylating)
     100061542
    1.14.14.-  
     100061542
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP2 family
   100061542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100061542
NCBI-ProteinID: XP_001502229
Ensembl: ENSECAG00000005643
Position
1
AA seq 490 aa AA seqDB search
MDLIVVLVLSLSCLLLLSLWKQSSRKGKLPPGPSPLPVIGNILQIDVKDISKTLINLSKV
YGPVFTLYFGMKPTVVLHGYEAVKEALIDLGEEFSGRGTFPVAERANRKYGIVLSNGKRW
KEMRRFSLMTLRNFGLGKRSIEDCVQEEARCLVEELRKTNASPCNPTFILGCAPCNVICS
IIFQNRFDYTDQNFLNLLELLNENVKILSSPWVQVCNTFPIFMDYFPGSHNDLLKNFAYI
KNYLLEKVKEHQESLDINNPRDFIDHFLIKMEQEKDNQQSEFTIENLIISAFDLFSAGSE
TTSTTLRYAILLLIKYPEVTVKVQEEIDRVIGRHRSPCMQDRSHMPYTDAVVHEIQRYID
IIPTNVPHAVTQDIKFRNYLIPKGTTILTSLTSVLHDDKEFPNPRVFDPGHFLDESGNFK
KSDYFMAFSAGKRICVGEGLARMELFLFLTNILQKFTLKSVVDPKDIDITPVANGFASVP
PSYQLHFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatctgattgtggtgctggtgctctctctctcctgtttgctcctcctttcactctgg
aaacagagctccaggaaagggaagctcccacctggtccctctcctctccctgttattgga
aatatcctgcagatagacgttaaggacatcagcaaaaccttaatcaatctctcgaaagtt
tatggccctgtgttcaccctatattttggcatgaagcccactgtggtgctgcatggatat
gaagcagtgaaggaagccctgattgatctgggagaggagttttctggaagaggcactttc
ccagtggctgaaagagctaatagaaaatatggaatagtactcagcaacgggaagagatgg
aaggagatgcggcgcttttccctcatgaccctgaggaattttgggttgggaaagaggagc
attgaagactgtgttcaagaggaagcccgctgccttgtggaggaattgagaaaaaccaat
gcctcaccttgcaatcccacttttatcttgggctgcgctccctgcaatgtgatctgctcc
attattttccagaatcgttttgattatacagatcagaatttccttaacttgttggaacta
ttgaatgaaaatgtcaagattctgagctctccatgggtgcaggtctgcaatactttccct
atttttatggattatttcccaggaagtcataatgatttacttaaaaattttgcttatata
aaaaattatcttttggagaaagtaaaagaacaccaagaatctctagacattaacaatcct
cgggacttcattgatcatttcctgatcaaaatggaacaggaaaaggacaatcaacagtct
gaatttactattgaaaatttgataatttctgcatttgatttattttctgctggatcagag
acaacgagcaccaccttgagatatgcaatcctgcttctgataaagtacccagaggtcaca
gtgaaagtccaggaagagattgaccgtgtgattggcagacaccgaagcccctgcatgcag
gacaggagccacatgccctacacggatgctgtggtgcacgagatccagagatacattgac
atcatccccaccaacgtgcctcatgcagtgacacaagatattaagttcagaaattacctc
atccctaagggcacaaccatattaacatctctgacttctgtgctgcatgatgataaagaa
ttccccaacccaagggtgtttgaccctggccactttctagatgagagtggcaactttaag
aagagcgactacttcatggctttctcagcaggaaaacgaatttgtgtgggagagggcctt
gcccgcatggaactatttttattcctgacgaacattttacagaaatttaccctgaaatct
gtggttgatccaaaggacatcgacatcactccagttgccaatgggtttgcttctgtgcca
ccttcttaccagctccatttcattcctgtctga

DBGET integrated database retrieval system