KEGG   Equus caballus (horse): 100062284
Entry
100062284         CDS       T01058                                 

Name
(RefSeq) gastric triacylglycerol lipase
  KO
K14452  gastric triacylglycerol lipase [EC:3.1.1.3]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00561  Glycerolipid metabolism
ecb01100  Metabolic pathways
ecb04975  Fat digestion and absorption
Module
ecb_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100062284
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    100062284
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     100062284
SSDB
Motif
Pfam: Abhydrolase_1 Abhydro_lipase Hydrolase_4 Abhydrolase_6 Cyclin_N
Other DBs
NCBI-GeneID: 100062284
NCBI-ProteinID: XP_001503148
Ensembl: ENSECAG00000009983
Position
1:40108579..40119241
AA seq 398 aa
MWLLLTTASLISALGTTHGFFGKLNPESPEVAMNISQMISYWGYPSEEYIVVTEDGYILE
INRIPYGKKNSENRGQRPVVFLQHGLLASSSNWISNLPNNSLGFLLADAGYDVWLGNSRG
NTWARRNIYYSPDSVEFWAFSFDEMAKYDLPSTIDFILKKTGQEKLHYVGHSQGTTIGFI
AFSTIPKLAKRIKAFYALAPVATVKYTKSLINKLTLIPPFLFKIIFGNKIFYPHNFFDEF
LATKVCSRETLNLICSNALFIICGFDNKNLNTSRLDVYLSHNPAGTSVQNMLHWTQAIKS
GKFQAFDWGSPVQNMAHYDQPSPPNYNLTDMRVPIAVWSGGNDWLADPQDVDLLLPKLSN
LTYHKKIPPYNHLDFIWAMNAPQEVYNEIISMMKEDKK
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtggttgttattaacaacagcaagtttgatctctgcacttggaactacacatggtttc
ttcggaaaattaaatccggaaagccctgaagtagctatgaatattagtcagatgatttcc
tattggggatacccaagtgaagaatatatagttgtgactgaagatggttatatccttgag
atcaacagaattccttacgggaagaaaaattcagagaatagaggccagagacctgttgtg
tttttgcagcatggtttgctagcatcgtcctcgaactggatttccaacttgcccaacaat
agcctgggcttccttctggcagatgctggttatgatgtgtggctggggaacagcagagga
aatacctgggccaggagaaatatatactattcaccagattcagttgaattctgggctttc
agctttgatgaaatggctaaatatgacctcccatctacaatcgacttcattttaaagaaa
actggacaagagaagctacactatgttggccattcccagggtaccaccattggttttatt
gctttttctaccattcccaagctggctaaaagaattaaagccttttatgcattagctcca
gttgccactgtgaagtatacgaaaagcctgataaacaaacttacacttattcctccattc
ctcttcaagattatatttggtaacaaaatattctacccacacaacttttttgatgaattt
cttgctactaaagtgtgctcccgtgagacgttgaacctcatctgcagcaatgccttattt
atcatttgtggatttgacaataagaacttgaacacgagtcgcttggatgtgtatctgtca
cacaacccagcgggaacttcagttcaaaacatgctccactggacccaggctattaagtcc
ggaaaatttcaagcttttgactggggaagcccagttcagaacatggcgcactatgatcag
ccttcacctcccaactataatttgacagacatgagagtgccaattgcagtgtggagcggt
ggcaatgactggttggctgaccctcaagacgttgacctcttgcttccaaaactctctaat
ctcacctaccacaagaagattcctccttacaatcacttggactttatctgggcaatgaat
gcccctcaagaagtttacaatgaaattatttctatgatgaaagaagataaaaaataa

DBGET integrated database retrieval system