KEGG   Equus caballus (horse): 100062448Help
Entry
100062448         CDS       T01058                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00010  Glycolysis / Gluconeogenesis
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100062448 (MINPP1)
   00562 Inositol phosphate metabolism
    100062448 (MINPP1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100062448 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100062448 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 SID DUF4708
Motif
Other DBs
NCBI-GeneID: 100062448
NCBI-ProteinID: XP_001503270
Ensembl: ENSECAG00000012951
VGNC: 20193
Position
1
AA seq 488 aa AA seqDB search
MMLRDPRRLLRVSVAPAAALAVAVLSSLSRCSLLEPEDCVISALSPYFGTKTRYEDVNPG
LLLDPEAPRRDPELLEETCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARGPGDDKT
CAAGSHDLRAALAAWPLGYAEWMDGQLVEKGWQDMRQLALRLASLFPALFSFENYCRLQL
ITSSKHRCVDSGAAFLQGLWQHYHPGLPPPDIADMECGTPRINDKLMRFFDHCEKLLTEV
ERNATALYHVEAFKTGPEMQNIVKKVAATLQVPVSNLSADLIQVAFFTCSFDLAIKGVKS
PWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQP
VSSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVL
YHCKNAKNPKEEFQVQMLLNEKVLPLAHSQETVSLYEDLKNHYKDILQNCHTSKECELPK
VNNTSDEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatgctccgcgacccccgccgccttctcagggtgtctgtggcccccgcggcggcccta
gctgtggccgtgctgtcgtcgctctcgcgctgctccctcctggagccggaggactgcgtg
atctcggcgctcagcccctacttcggcaccaagactcgctacgaggatgtcaaccccggg
ctgctgctggaccccgaggcgccgcggcgggacccggagctgttggaggagacctgcacg
ccggtgcagctggtcgccctcatccgccatggcacccgctaccctacggccaaacagatc
cgcaagctgcgacagctgcacggcttgctgcaggcccgcgggcccggggatgacaagacc
tgcgctgccggcagtcacgacctgagggccgcgctggccgcctggccgctggggtacgcg
gaatggatggacgggcagctggtggagaaggggtggcaggacatgcgacagctggcgctg
cgcctcgcttcccttttcccggccctcttcagtttcgagaactactgccgcctgcagctc
atcaccagctccaagcatcgctgcgtggacagcggcgccgccttcctgcaggggctgtgg
cagcactaccaccctgggttgccgccgccggacatcgcagacatggagtgtgggactcca
agaattaatgataaactaatgaggttctttgatcattgtgagaagcttttaactgaagtg
gaaaggaatgctactgctctttatcatgtagaagccttcaaaactggaccagaaatgcag
aacattgtaaaaaaagttgcagctactttgcaagtaccagtcagcaatttaagtgcagat
ttaattcaggtagctttttttacctgttcatttgacctggcaattaaaggtgttaaatct
ccttggtgtgatgtttttgacatagatgatgcaaaggtattagaatatttaaatgatctg
aagcaatattggaaaagaggatatgggtatactattaatagtcgatccagctgcaccctg
tttcaggatatctttcagcacttggacaaagcagttgaacagaaacaaaggtctcagcca
gtttcctccccagtcatccttcagtttggtcatgcagagacacttcttccactgctttct
ctcatgggctacttcaaagacaaggagcccctaacagcttacaattataaggaacaaatg
catcggaagttccgaagcggtcacattgtaccctatgcctcgaacctaatatttgtgctt
taccattgtaaaaatgctaagaatcctaaagaagaattccaagtgcagatgttattgaat
gaaaaggtgttaccattggctcactcacaagaaactgtttctttgtatgaggatctgaag
aaccactataaggacatccttcagaattgtcataccagtaaagaatgtgaattaccaaag
gtgaacaacacatctgatgagctgtaa

DBGET integrated database retrieval system