KEGG   Equus caballus (horse): 100062625
Entry
100062625         CDS       T01058                                 

Definition
(RefSeq) general transcription factor II-I repeat domain-containing protein 2 isoform X3
Organism
ecb  Equus caballus (horse)
SSDB
Motif
Pfam: GTF2I DUF4371 zf-C2H2_12 DUF5344
Other DBs
NCBI-GeneID: 100062625
NCBI-ProteinID: XP_001494185
Ensembl: ENSECAG00000021592
UniProt: F6YB97
Position
13
AA seq 947 aa
MAQVAVSTLSVENESTESRMVVTFLVSALESMCKELAKSKAEVACIAVYETDVFVVGTDR
GRAFVNARADLQKDFAKYCIAAGLPEVKPPRPANGMPMESGETEILRKAVEDYFCLCYGK
ALGTTVMVPVPYEKMQRDQAAVRVQGLPEGVTFQHPENYDLATLKWILEKKAGISFVINR
PFLGPANQLGGPVVVTDAERSMTSPSESCGSINVKTEPMEDSGISVKAAAVSVKKESDDP
NYYRYNMQESHHSSGSSEVIEMELPMEDSTQLVPPETSEDPEAEVKTEGNIISSRLTDSA
AGVEDLNIVQVPVPDNEKERLPSIEKIKQLREQVNDLFSRKFGEAIGVDFPVKVPYRKIA
FNPGCVVIDGMPPGVVFKAPGYLEISSMRRILDAAEFIKFTVLRPLPGLELSNVGKRKID
QEGRVFQEKWERAYFFVDVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYTEKMR
DEKLHELKKGLRKYLLGSSEIVCPEQHQGFANVSPAEAAAVQPVEDVAGHLWEKLREKIK
SFVAYSVAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFLRVEKS
LKKFNIDWSKLVSVASTGTPAMVDANDGLVTKLKSKVAMVGKGSDLKSMCCILHPESLCA
QKLKMDHVMSVVVSSVNWICSRGVNHSEFTTLLYELDSQYGSLLYCTEIKWLSRGLVLKR
FFESLEEIDSFMSSRGKPLPQLSSQDWIKDLAFLVDMTTHLNTLNISLQGHSQIVTQMYD
LIRAFLAKLCLWETHLARNNLAHFPTLKSVSRNESDGLNYIPKIVELKTEFQKRLSEFKL
YESELTLFSSPFSMKIESVPEALQMEVIDLQCNTVLKTKYDKVGIPEFYRYLWSSYPRYK
THCAKILSMFGSTYICEQLFSIMKLSKTKFCSQLKDSQWDSVLHITA
NT seq 2844 nt   +upstreamnt  +downstreamnt
atggcccaggtggcagtgtctaccctgtccgtcgaaaatgagtccacggagagcaggatg
gtggtgacgttcctcgtttctgctctcgagtccatgtgtaaagaactggccaagtccaag
gcggaagtggcctgcatcgccgtgtacgagacagacgtgttcgtcgtcggcaccgacaga
ggacgcgcttttgtcaacgccagggcggacctgcagaaggattttgcaaaatactgcatc
gctgcagggctgcctgaggtgaagcccccgcgcccggcgaacgggatgccgatggagtca
ggagagacggaaatactccgaaaagcggtcgaggactatttctgcctttgttatggtaaa
gccttagggactacagtgatggtgcctgtgccgtacgagaagatgcagagagaccaggcg
gctgtgcgagtgcagggccttccagaaggagtcacctttcaacacccagagaactatgat
cttgcaaccctgaaatggattctggagaagaaagcggggatttcattcgtcataaacaga
cctttcctaggtccagcgaatcagctaggtgggcctgtagtggtgacagatgctgagaga
tcgatgacatcgccaagtgaaagttgtggctccatcaatgtgaaaactgagcccatggaa
gattctggcatttctgtgaaagcagcagctgtgtcagtcaagaaagaatcagatgatcct
aattactatcgatataatatgcaagaaagccatcattcttcggggagcagtgaagtaata
gaaatggaattaccaatggaagattctactcagcttgtccctccagaaacgagtgaggac
cccgaagctgaggtgaaaactgaaggaaacatcatctcatcccgtcttacagattccgcg
gcaggggttgaggacctcaacatcgtccaggtgccagttccagacaatgagaaggaaaga
ttaccaagtattgaaaagataaagcaactaagagaacaagtcaatgacctctttagccga
aaatttggtgaagcaatcggagtggacttccccgtgaaggtgccctacaggaagatcgcc
ttcaaccctggctgcgtggtcatcgatggcatgccgcccggggtggtcttcaaagccccc
ggttacctggaaatcagctccatgcgcaggatcttggatgcggcagaatttatcaaattc
acagtccttagaccgcttccaggcctcgagctcagcaatgtgggaaaacgaaagatagac
caggagggccgtgtatttcaagagaagtgggagagagcgtatttcttcgtggacgtgcag
aatatcccgacctgtttaatatgcaaacagagcatgtcagtgtcgaaagaatacaaccta
agacgccactatcagaccaaccacagcaagcactatgaccagtacaccgagaagatgcgc
gatgagaagcttcacgagctcaaaaaaggcctcaggaagtatctcctggggtcctcagaa
atcgtgtgtcccgagcaacatcaagggtttgcaaacgtgagtcccgctgaagctgctgcc
gtgcagcctgtagaagatgtggccgggcacttatgggagaagctacgtgaaaaaatcaag
tcatttgtggcatattctgttgcaatcgatgagatcacagatataaataataccacccag
ttggccatattcatccgtggtgttgatgagaattttgatgtgtcggaagaacttttggat
acagtgcccatgacaggtacaaaatctggaaatgagatatttttgagggttgagaaaagt
cttaaaaagtttaatatcgactggtcaaaattagtaagcgtggcctcaacgggcacccct
gcgatggtagacgcgaacgacggacttgttacgaaactcaagtccaaagtggcgatggtt
ggcaagggctcagatctgaagtccatgtgctgcatccttcacccggaatcactctgcgct
cagaagttaaagatggaccacgtcatgagcgtggtcgtcagctcggtgaactggatatgc
tcccgcggagtgaaccacagtgagttcacgacgttgctttatgaactggacagccaatat
ggcagccttctgtactgcacggagatcaagtggctcagccgggggctggtgctgaagaga
ttttttgaatccttggaagaaatcgattccttcatgtcatccagaggaaagcccttgccc
caactgagctctcaagattggatcaaagacttggccttcttggtcgatatgacgacgcac
ctgaacactttgaacatctctctccaaggccattcacagatcgttacgcaaatgtacgac
ttgattcgggcattcctggcaaaactgtgtctttgggaaactcatctggcgaggaataat
ctggcccactttcccaccctgaaatcagtttccaggaatgaaagcgatggcctgaactac
attcccaaaattgtggaattaaagactgaattccagaaaaggttgtctgagttcaaactc
tatgaaagcgagctgaccctgttcagctcccccttctccatgaagatcgagagcgtgcct
gaagcgctgcagatggaggtcattgatctgcagtgcaacacggtcctgaagactaaatac
gacaaggttgggataccggaattctacagatacctctggagtagctacccgagatataaa
actcactgcgcgaagatcctctccatgttcgggagcacctacatttgtgagcagctgttt
tccattatgaaactgagtaaaaccaagttctgctcccagttaaaggactcccagtgggac
tctgtactccacatcacggcgtga

DBGET integrated database retrieval system