KEGG   Equus caballus (horse): 100063302
Entry
100063302         CDS       T01058                                 

Gene name
KRT1
Definition
(RefSeq) keratin 1
  KO
K07605  type II keratin, basic
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ecb04812]
    100063302 (KRT1)
   04147 Exosome [BR:ecb04147]
    100063302 (KRT1)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     100063302 (KRT1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100063302 (KRT1)
  Exosomal proteins of other body fluids (saliva and urine)
   100063302 (KRT1)
  Exosomal proteins of colorectal cancer cells
   100063302 (KRT1)
  Exosomal proteins of bladder cancer cells
   100063302 (KRT1)
SSDB
Motif
Pfam: Filament Keratin_2_head Keratin_2_tail TPR_MLP1_2 Spc7 Alanine_zipper ADIP DUF1664 ABC_tran_CTD Baculo_PEP_C AAA_13 Tropomyosin_1 SlyX ATG16 CENP-F_leu_zip MukF_M DUF812 She9_MDM33 DUF4140 HOOK DUF745
Other DBs
NCBI-GeneID: 100063302
NCBI-ProteinID: NP_001333128
VGNC: 19520
UniProt: F7B7X0
Position
6
AA seq 626 aa
MSRNFSSRSGRRIGGGFSSGSAGVVSFQRRTTSSSVCRGGGGGGGFSGGRYGAGCAGGGF
GSRSLVNLGGNKSISISVARGGGRSGFGGGYGGGGFGVGGYGGGGFGGGGFGSGGFGGGG
FGSGGFGGGFGSGGFGGGFGSGGGFGGGGFRGGFGPVCPPGGIQEVTINQSLLQPLNVEI
DPEIQRVKSQEREQIKTLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTPTRTQSLEP
IFEAYISSLRRQVDQLKSDQSRMDSELKNMQDVVEDYRNKYEEEINKRTNAENEFVTIKK
DVDAAYITKVDLQAKVDNLRQEIEFLRILYQEELSQLQTHISDTNVILSMDNNRHLDLDS
IIAEVRAQYEDIAQKSKAEAEALYQSKYEELQITAGSHGDSLKSTKMEISELNRVIQRLR
SEIDSVKKQIAALQQSITEAEQRGENALKDAQNKLNELEDALQRAKEDLARLLRDYQELM
STKLALDVEIATYRTLLEGEESRMSGECAPNVSVSVSTSHTSISGGGVRGGGGFSSGGGG
SYSSGGGSYSSGGGGGGFGSGGSSRGHRGGSGGGGGSSGGWGSGGGGSGGSFSSSGGRGV
SSGGSKSSGGSSSVKFVSSSYSRGSR
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgagccgaaactttagttccaggtctggccgccggattggagggggcttcagctctggc
tctgctggggtggtcagcttccagcgcaggaccactagcagctctgtgtgccgtggtggg
ggaggtggcgggggattttcagggggaagatatggtgctggctgtgctggcggtggtttt
ggaagtcggagtcttgttaacctcggtggcaataagagcatctccataagtgtggctaga
ggaggtggacgtagtggttttggtggtggttatggcggtggtggctttggggttggtggc
tatggcggtggtggctttgggggtggtggctttggcagtggtggctttgggggtggtggc
tttggcagtggtggctttgggggtggttttggcagtggcggttttgggggtggctttggc
agtggaggtggttttggtggaggtggttttcggggtggttttgggcctgtctgcccccct
ggtggcatacaggaagtcaccatcaatcagagccttctgcaaccactcaatgtggagatt
gatcctgagatccaaagagtaaagtctcaagaaagggagcaaattaagaccctcaacaac
caatttgcctcctttattgacaaggtgcggttcctggagcagcagaaccaggtgctgcag
acaaaatgggagctgctgcagcaggtggacacccctacgagaacccagagcctagaaccc
atttttgaggcgtatatcagcagtcttagacggcaagtggaccagctgaagagcgaccaa
tctcggatggattcagaactgaagaacatgcaagacgtggtggaagattaccggaacaag
tacgaggaagagatcaacaagcggacaaatgcagagaatgaatttgtgaccatcaagaag
gacgtggatgctgcttatataaccaaggtggacctgcaggccaaagttgacaacttgcgt
caggaaattgagttcctcagaatactctaccaagaggagctgtctcagttgcagacacac
atcagtgacactaatgtcatcctgtccatggacaacaaccggcacctggacctggacagc
attatcgctgaggtccgtgcccagtatgaggacatcgcccagaagagcaaggcggaggct
gaggcgctgtaccagagcaagtatgaagagctccagatcactgctggcagccatggggac
agtttgaaaagtacaaagatggagatttctgagctgaatcgggtgatccagagacttaga
tctgaaattgacagcgtcaagaagcagatcgctgcgctgcagcagtccatcactgaagct
gagcagcgtggggagaacgccctcaaagacgcccagaacaagctgaacgagctggaggat
gccctgcagagggccaaggaggacctggcccggctgctgcgtgactaccaggagctgatg
agcaccaagctggccctggatgtggagattgccacctacaggaccctcttggaaggagag
gagagcaggatgtctggagagtgcgccccgaacgtgagcgtgtctgtgagcaccagccac
acgagcatcagtggaggaggagtccgaggaggcggcggtttcagctctggcggcggaggg
agctacagctctggaggaggcagttacagctctggaggcggcggtggtggcttcggctcc
ggaggcagcagtaggggccacagaggcggctctggaggtggaggcggcagctctggcggc
tggggttctggtggcggcggctctggaggcagcttcagctcgtccggaggccggggagtc
agctctgggggcagcaagtcctctggtggcagttccagcgtgaaatttgtttccagcagc
tactcccgagggagcagataa

DBGET integrated database retrieval system