KEGG   Equus caballus (horse): 100063433
Entry
100063433         CDS       T01058                                 

Gene name
SLC7A11
Definition
(RefSeq) cystine/glutamate transporter
  KO
K13869  solute carrier family 7 (L-type amino acid transporter), member 11
Organism
ecb  Equus caballus (horse)
Pathway
ecb04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100063433 (SLC7A11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecb02000]
    100063433 (SLC7A11)
Transporters [BR:ecb02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100063433 (SLC7A11)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 100063433
NCBI-ProteinID: XP_005607903
Ensembl: ENSECAG00000022696
VGNC: 23267
UniProt: F6SEZ0
Position
2
AA seq 503 aa
MVRKPVVSTISNGGYLQGNVNGRLPSLGSKEPPEQEKVVLKKKITLLRGISIIIGTIIGA
GIFISPKGVLQNTGSVGMSLIIWTVCGVLSLFGALSYAELGTSIKKSGGHYTYILEVFGP
LPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLN
SMSVSWSARIQIFLTFCKLTAIVIIIVPGVMQLIKGQTQHFKDAFSGRDANIMGLPLAFY
YGMYAYAGWFYLNFLTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTISAEELLLS
NAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHV
RKHTPLPAVIVLHPLTMIMLFSGDLYSLLNFLSFARWLFIGLAVAGLIYLRYKRPDMHRP
FKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRRM
SDRITRTLQIILEVVPEEDCHKL
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggtcagaaagcctgttgtgtccaccatctccaatggaggttacctgcaggggaatgtt
aacggcaggctgccttccctgggcagcaaggagccccctgagcaggagaaagtggtgctg
aagaagaaaatcactttgctgaggggcatctccatcatcattggcaccatcattggagcc
ggaatcttcatctctcctaagggcgtgctccagaacacgggcagcgtgggcatgtctctg
ataatctggacggtctgtggggtcctgtcactatttggagccttgtcctatgccgaattg
ggaaccagtatcaagaaatctggtggtcattatacatatattctggaagtctttggcccg
ttaccagcttttgtacgagtctgggtggaactactcataatacgccctgcagccactgct
gtgatatctctggcatttggacgctacattctggaaccattttttattcaatgtgaaatt
cctgaacttgcaatcaagctcattacagctgtgggcataactgtagtgatggtcctaaat
agcatgagtgtcagctggagcgcccggatccagattttcctaaccttttgcaagctcaca
gcaattgtgataattatagtccctggagttatgcagctaattaaagggcaaacacaacac
tttaaagatgccttttcaggaagagatgcaaatattatgggattgccactggctttctat
tatggaatgtatgcatatgctggctggttttatctcaactttcttactgaagaagtggaa
aatcctgaaaaaaccatcccccttgcaatatgtatatccatggccatcgtcaccattggc
tacgtgctgacaaatgtggcctactttacgaccattagtgccgaggagctattgctttcc
aatgccgtggcggtgaccttttctgagcggctactgggaaatttctcattagcagttccg
atcttcgttgccctctcctgctttggctccatgaatggtggtgtatttgctgtctccagg
ttattctatgttgcgtctcgagagggtcaccttccagaaatcctctccatgattcatgtc
cgcaagcacactcctctgccagctgttattgttttgcaccctttgacgatgataatgctc
ttctctggggacctctacagtcttttgaatttcctcagttttgccaggtggctttttatt
gggctggcagttgctgggctgatttatcttcgatacaaacgccccgatatgcatcgtcct
ttcaaggtgccgctcttcatcccagctttgttctccttcacatgtctcttcatggttgcc
ctttcgctttattcggacccatttagcacagggattggcttcgtcatcactctgactgga
gtccctgcctactatctcttcattatatgggacaagaaacccaggtggtttagaagaatg
tcagacagaataaccagaacattacaaataatactggaagttgtacctgaagaagactgt
cataaattatga

DBGET integrated database retrieval system