KEGG   Equus caballus (horse): 100063593Help
Entry
100063593         CDS       T01058                                 

Gene name
PLK4
Definition
(RefSeq) serine/threonine-protein kinase PLK4 isoform X2
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100063593 (PLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100063593 (PLK4)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100063593 (PLK4)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     100063593 (PLK4)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   100063593 (PLK4)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100063593 (PLK4)
   Centrosome duplication proteins
    Regulators of centriole replication
     100063593 (PLK4)
  Sister chromatid separation proteins
   Polo kinases
    100063593 (PLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 POLO_box Pkinase_fungal Kinase-like Haspin_kinase DUF4520
Motif
Other DBs
NCBI-GeneID: 100063593
NCBI-ProteinID: XP_014593471
Ensembl: ENSECAG00000008187
VGNC: 21582
Position
2
AA seq 894 aa AA seqDB search
MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNE
VKIHCQLKHPSILELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSENEARHFMHQI
ITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISP
EIATRSAHGLESDVWSLGCMFYTLLTGRPPFDTDTVKNTLNKVVLADYKMPTFLSREAKD
LIHHLLRRNPADRLSLSSVLEHPFMSRNSSTKSKDLGTVEDSIDSGHATISTAVTASSST
SMSGSLFDRRRLLIGQPLPNKMTIFPKSKIANDFSSSGDGSSFYTQWGNQEQEISNSGRG
RVIQDAEERPHSRYLRRAHSSDRSGTSNTQSPGKTYTMERCHSAEVLSKSKRSGVDENEE
RYSPTNSNVNIFHFFKEKASNCSGSFERPDNDQALSNRLCPGKTPFPFPDQISQTEMVQQ
WFGNLQVKDPLSEQSKTRDMEPPVGYQKHTLRSITSPLTAYRLKPIRQKTKKAVVSILDS
EEVCVELLKEFTSQEYVKEVLQISSDGNMITIYYPNDGRGFPLAERPPSPTDNISRYSFD
SLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCVLMENSPGADFEVWFYDGAKIHKT
EDLIHVIEKTGKSYTLKGESEVNSLKEELKIYMDHANEGHRICLALESIISEEENKSGGA
PFFPIIIGRKPGNTSSPKALSPTPSVDPNYPMRERPSLNRMIINSAASSKQAPILSPSTV
TGEGLGATALASGTSISPSGVNDCLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQ
LVVQAGVSSISYTSPNGHTTRYGENEKLPEYIKQKLQCLSSILLMFSNPTPGFH
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctgcatcggggagaagatcgaggattttaaagttggaaatctgcttggtaaa
ggatcatttgctggtgtctacagagctgagtccattcacactggtttagaagttgcaatc
aaaatgatagataagaaagccatgtacaaagctggaatggtacagagagtccaaaatgag
gtgaaaatacattgccaattgaagcatccttctatcttggagttgtataactattttgaa
gataacaattatgtgtacctagtattagaaatgtgccataatggagaaatgaacaggtat
ctaaagaacagaatgaaaccattctcagaaaatgaagctcgacacttcatgcaccagatc
atcacaggaatgttatatctccattctcatggtatattacaccgggacctcacgctttct
aacctcttacttacgcgtaatatgaacatcaagattgccgattttgggctggcaactcaa
ttgaaaatgccacatgaaaaacactatactttatgtggaactcctaattacatttcacca
gagattgcaactcgaagtgcacatggtcttgaatctgatgtttggtccttgggctgtatg
ttttatacgttgcttactgggagaccaccttttgacacggacacagttaagaacacctta
aataaagtagtattggcagattacaaaatgccaacttttttgtcaagagaggccaaggac
cttattcaccacttacttcgtagaaacccagcagatcgtttaagtctgtcttcagtgtta
gagcatccttttatgtcccggaattcttcaacaaaaagtaaagatttaggaactgtggaa
gactcaattgatagtggacatgccaccatttctactgctgttacggcttcttccagtacc
agtatgagtggtagtttatttgacagaagaaggcttttgattggtcagccactcccaaat
aaaatgactatttttccaaagagtaaaattgcaaatgatttttcttcttcaggagatgga
agcagtttttatactcagtggggaaatcaagaacaagaaatcagtaatagtggaagggga
agagtaatccaagatgcagaagaaaggccacattcccgctaccttcgtagagcccattcc
tctgatagatctggcacttctaacactcagtctccaggaaaaacgtatacaatggaacga
tgtcactcagcagaagtgctttcaaaatccaaaagatcaggagtagatgaaaatgaagaa
cgatactcacccacaaacagcaatgtcaatatttttcacttctttaaagaaaaggcatcc
aattgttctggatcttttgaaagacctgataatgatcaagcactttccaatcgtctttgt
ccaggaaaaactccttttccatttccagaccagatatctcaaactgaaatggtgcaacag
tggtttgggaatctgcaagtaaaagatcctctttctgaacaaagcaagactagggatatg
gagccaccagtgggttatcagaaacatacgttacgaagcattacgtctcctttgactgct
tacaggttaaaaccaatcagacagaaaaccaaaaaggctgtggtgagcatacttgattca
gaggaggtatgtgtggagcttctaaaggagtttacatctcaagaatatgtgaaagaagtt
cttcaaatatctagtgatggaaatatgatcactatttattatccaaatgatgggagaggt
tttcctcttgctgagagaccaccctctcctactgacaacatcagtaggtacagctttgac
agtttaccagaaaagtactggcgaaaatatcaatatgcttccagatttgtacagcttgta
agatctaaatctcccaaaatcacttattttacaagatatgctaaatgtgttttgatggag
aattctcctggtgctgattttgaggtttggttttatgatggagcaaagatacacaaaaca
gaagatttaattcatgttattgaaaagactgggaaatcttacaccttaaaaggtgaaagt
gaagttaatagcttgaaagaggaactaaaaatttatatggaccatgctaatgagggtcat
cgtatttgtttagcactagaatccataatttcagaagaggaaaacaaaagtggaggtgct
ccctttttcccaataatcataggaagaaaacctggtaatactagttcacctaaggcctta
tcacctactccttctgtggatccaaactacccaatgagagagagaccatctttgaataga
atgatcataaatagtgctgcttcttcgaaacaggcgccgatacttagtccttctacggtt
acaggtgaaggacttggcgccacagctctggcctccggaacaagcatctctcctagtggt
gtgaacgattgtcttcctaaatcagcacaacttttgaagtctgtttttgtgaaaaatgtt
ggttgggctacacagttaactagtggagctgtgtgggttcagtttaatgatgggtcccag
ttggttgtccaggcaggagtgtcttctatcagttatacatccccaaatggtcacacaact
aggtatggagaaaatgaaaaattaccagaatacatcaaacagaaattacagtgtctttct
tccatccttttgatgttttctaatccaactcctggttttcactga

DBGET integrated database retrieval system