KEGG   Equus caballus (horse): 100064155
Entry
100064155         CDS       T01058                                 

Gene name
CALCOCO1
Definition
(RefSeq) calcium-binding and coiled-coil domain-containing protein 1
Organism
ecb  Equus caballus (horse)
SSDB
Motif
Pfam: CALCOCO1 SKICH Zn-C2H2_12 Fez1 Golgin_A5 Vps23_core
Other DBs
NCBI-GeneID: 100064155
NCBI-ProteinID: XP_001504596
Ensembl: ENSECAG00000024023
VGNC: 16005
UniProt: F6Y1D3
Position
6
AA seq 691 aa
MEESSLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRD
YHTFVWSSVPESATDGAPVHASVQFQASYLPKPGAQLYQFRYVNRQGRVCGQSPPFQFRE
PRPMDELVTLEETDGGSDILLVVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSR
VQELETALATARQGHADLTEQYKGLSRSHGELTEERDILSRQQGDHVARILELEDDIQTI
SEKVLTKEVELDRVRDTVKALTREQEKLLGQLKEVQADKEQSEAELQMAQQENHRLNLEL
QEAKGRQEEQSAQAQRLKDKVAQMKETLGQAQQRVTELEPLKEQLRGAQELAASSQQKAA
LLGEELASAAGARDRTMAELHRSRLEVAGVNGRLAELTLHLKEEKSQWSKERAGLLQSVE
AEKDKILKLSAEILRLEKAVQEERTQNQVYKTELAREKDSSLVQLSESKRELTELRSALR
VLQKEKEQLQEEKQELLEYMRKLEARLEKVADEKWNEDAATEDEEGAAGLSCPAPLTDSE
DESPEDMRLPPYGLCEHGDPGSSPAGPREASPLVVISQPAPIAPHLSGPAEDSSSDSEAE
DEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFAVGPLSEASTGGPATPPWKECPICK
ERFPAESDKDALEDHMDGHFFFSTQDPFTFE
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggaagaatcatcactaagccgggccccatcccggggtggagtcaactttctgaatgta
gcacggacctacatccccaacaccaaggtggaatgtcactacacccttcccccaggcacc
atgcctagtgccagtgactggattggcatcttcaaggtggaggcagcatgtgttcgggat
taccacacatttgtgtggtcttcggtgcctgaaagtgcaaccgatggtgcccctgtccat
gccagtgtccagttccaagccagctacctgcccaaaccaggagcccagctctaccagttc
cgctacgtgaaccgccagggccgggtgtgtgggcagagcccccctttccagttccgagag
ccaaggcccatggatgaactggtgaccctggaggagactgacgggggctctgacatcctg
ctggttgttcccaaggcaactgtgctgcagaaccagctggacgagagccagcaggagagg
aatgacctgatgcagctgaagctgcagctggaggggcaggtgacagagctgaggagccga
gtacaggagctcgagacagctctggccaccgccaggcaggggcacgcagacttgacggag
cagtacaaggggctttcccggtcccacggggagctcacggaagagagggacattctgagc
cggcaacagggagaccatgtggcacgcatcctggagctggaggatgacatccagaccatc
agtgagaaagtgctgacaaaggaggtggagctggatagggttagagacacagtgaaggct
ctgactcgggaacaagagaagctccttgggcaactgaaggaggtgcaagcggacaaggag
caaagtgaggctgagctccaaatggcacaacaggagaaccatcgcttgaatttggagctg
caggaggccaagggccggcaggaggagcagagtgctcaggcccagcgactgaaggacaag
gtggcccagatgaaggaaaccctaggccaggcccagcagcgggtgactgagctggagccc
ctgaaggagcagcttcgaggggcccaggagcttgcagcctctagccagcagaaagccgcc
ctccttggggaggagttggccagcgcagcgggagccagggaccgcaccatggccgagcta
caccgcagccgcctggaagtggctggagtcaacggcaggctggctgagctcaccctgcac
ttgaaggaggaaaaaagccagtggagcaaggagcgggcagggctcctgcagagtgtggag
gcagagaaggacaagatcctgaagctgagtgcagagattcttcgactagaaaaggcagtg
caggaggagaggacccagaatcaagtgtacaagactgaactggcccgggaaaaggattct
agtctggtgcagttgtcagagagcaagcgggagctgacagagctgcggtcagccctgcgc
gtgctccagaaggaaaaggagcagttgcaggaggagaagcaggaactgctggagtacatg
agaaagctggaggcccgcctggagaaagtggcagatgagaagtggaatgaggacgctgcc
acagaggacgaggagggtgctgcgggactgagctgcccagcgcctctgacagactcagag
gatgagtccccagaagacatgagactgccaccctatggcctgtgtgagcacggagaccca
ggctcctctcctgctgggccacgagaggcttctcccctagttgtcatcagccagccggct
cccattgctccccacctctcagggccagctgaggacagtagctctgactcggaggctgaa
gatgagaagtcagtcctgatggcagctgtgcagagtgggggtgaggaggccaacctgctg
cttcctgaactgggcagtgccttctatgacatggccagtgggtttgcagtgggtcccttg
tcagaggccagcactgggggccctgccacccccccgtggaaggagtgccctatttgtaag
gagcgcttcccagctgagagtgataaggatgccctggaggaccacatggatggacacttc
ttcttcagcacccaggaccctttcacctttgagtga

DBGET integrated database retrieval system