KEGG   Equus caballus (horse): 100064287Help
Entry
100064287         CDS       T01058                                 

Definition
(RefSeq) cytochrome P450 4B1 isoform X1
  KO
K07426  cytochrome P450 family 4 subfamily B polypeptide 1 [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100064287
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP4 family
   100064287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100064287
NCBI-ProteinID: XP_005607131
Ensembl: ENSECAG00000014840
Position
2
AA seq 514 aa AA seqDB search
MVPVLLPLSLSYLGLWASGLILVLGFLKLLSLLLRRQKLARAMDSFPGPPTHWLFGHALE
LQQTGSLDKVVSWAHQFPYAHPLWYGQFLGFLNIYEPDYAKAVYSRGDPKAPDVYDFLLQ
WTGEGLLVLHGPKWFQHRKLLTPGFHYDVLKPYVAVFANSAHTMLEKWEEMAREDKSFDI
FCDVGHMALDTLMKCTFGKADTGLCHRDSSYYQAVCELTLLTQQRIDSFQYHNDFIYWLT
PHGRRFLRACQVAHDHTDRVIRERKAALQDEKEQEKIRKRRHLDFLDILLGARDEDGIKL
SDAELRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQRCREEVREVLGDRDSFQWDDL
GKMTYLTMCIKESFRLYPPVPQVFRQLSKPVSFVDGRSLPAGSLVSLHIFALHRNSAVWP
DPEVFDPLRFSSENVARRHPFAFIPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFALDP
LRLPILLPQLVLRSRNGIHLHLKPLGPGSGKQLC
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctgtcctgctccccttgagtctgtcctacctgggcctgtgggcttctggactg
atcttggtcttaggcttcctcaagctccttagtctgctgctgcggaggcagaagctggcc
agggctatggacagcttcccaggtccccccacgcactggctcttcgggcacgccctcgag
ctccagcagacagggagcctggacaaggtggtgtcctgggcccaccagttcccctacgcc
cacccactctggtatgggcagttccttggcttcctgaacatctatgagcctgactatgcc
aaagctgtgtatagccgaggggaccctaaggcaccggatgtttatgacttcctccttcag
tggactggggaaggcctgctggtccttcatgggcccaaatggttccagcaccgcaagctg
ctcacgcctggcttccattatgatgtactgaagccttacgtggccgtgttcgccaactcc
gcccacaccatgctggaaaagtgggaggagatggctcgtgaagataagagctttgacatc
ttctgtgatgtgggccacatggcgctggacactctcatgaagtgcacctttggcaaagca
gacactggcctgtgtcacagggacagtagctattaccaggcggtctgtgagctcactctg
ctgacacagcagcgcatcgactccttccagtaccacaacgacttcatctactggctcacc
ccccatggccgccgcttcctgcgggcctgccaggtggcccacgaccacacagaccgggtc
atcagggaacggaaggcagccctgcaggacgagaaagagcaggagaagatccggaagcgg
aggcacctggacttcctggacattctcctgggggctcgggatgaagatgggatcaagctg
tcagatgccgagctccgcgctgaggtggacacgttcatgtttgaaggccatgacaccacc
accagtggcatctcctggtttctctattgcatggccctgtaccctgagcaccagcagcgt
tgtcgggaggaggtgcgcgaggtccttggggaccgagactccttccagtgggatgatctg
ggcaagatgacctacttgaccatgtgcatcaaggagagcttccgcctctacccgcccgtg
ccccaggtgttccgccagctcagcaagcccgtcagcttcgtggatggccgctccctaccc
gcaggcagcctggtctctctgcacatcttcgccctccataggaacagcgcagtgtggccc
gaccctgaggtctttgaccccctgcgcttttcatctgagaacgtggccaggcgccatccc
tttgccttcatacccttctccgctgggcccaggaactgcatcgggcagcagtttgccatg
aacgagatgaaggtggtcacggccctctgcttgctgcgctttgagttcgccctggacccc
ttgcggctgcccatcctgttgcctcagctggtcctgcgctccaggaatggcatccatctg
cacctgaagccgctgggcccgggctctgggaagcagctctgctga

DBGET integrated database retrieval system