KEGG   Equus caballus (horse): 100064302Help
Entry
100064302         CDS       T01058                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X3
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04020  Calcium signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04114  Oocyte meiosis
ecb04140  Autophagy - animal
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04310  Wnt signaling pathway
ecb04340  Hedgehog signaling pathway
ecb04371  Apelin signaling pathway
ecb04530  Tight junction
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04740  Olfactory transduction
ecb04742  Taste transduction
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04910  Insulin signaling pathway
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing's syndrome
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04962  Vasopressin-regulated water reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04976  Bile secretion
ecb05012  Parkinson's disease
ecb05020  Prion diseases
ecb05030  Cocaine addiction
ecb05031  Amphetamine addiction
ecb05032  Morphine addiction
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05166  HTLV-I infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05414  Dilated cardiomyopathy (DCM)
Module
ecb_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100064302 (PRKACA)
   04010 MAPK signaling pathway
    100064302 (PRKACA)
   04310 Wnt signaling pathway
    100064302 (PRKACA)
   04340 Hedgehog signaling pathway
    100064302 (PRKACA)
   04371 Apelin signaling pathway
    100064302 (PRKACA)
   04020 Calcium signaling pathway
    100064302 (PRKACA)
   04024 cAMP signaling pathway
    100064302 (PRKACA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100064302 (PRKACA)
  Cell growth and death
   04114 Oocyte meiosis
    100064302 (PRKACA)
  Cellular community - eukaryotes
   04530 Tight junction
    100064302 (PRKACA)
   04540 Gap junction
    100064302 (PRKACA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100064302 (PRKACA)
   04062 Chemokine signaling pathway
    100064302 (PRKACA)
  Endocrine system
   04911 Insulin secretion
    100064302 (PRKACA)
   04910 Insulin signaling pathway
    100064302 (PRKACA)
   04922 Glucagon signaling pathway
    100064302 (PRKACA)
   04923 Regulation of lipolysis in adipocyte
    100064302 (PRKACA)
   04912 GnRH signaling pathway
    100064302 (PRKACA)
   04913 Ovarian Steroidogenesis
    100064302 (PRKACA)
   04915 Estrogen signaling pathway
    100064302 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    100064302 (PRKACA)
   04921 Oxytocin signaling pathway
    100064302 (PRKACA)
   04926 Relaxin signaling pathway
    100064302 (PRKACA)
   04918 Thyroid hormone synthesis
    100064302 (PRKACA)
   04919 Thyroid hormone signaling pathway
    100064302 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    100064302 (PRKACA)
   04916 Melanogenesis
    100064302 (PRKACA)
   04924 Renin secretion
    100064302 (PRKACA)
   04925 Aldosterone synthesis and secretion
    100064302 (PRKACA)
   04927 Cortisol synthesis and secretion
    100064302 (PRKACA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100064302 (PRKACA)
   04270 Vascular smooth muscle contraction
    100064302 (PRKACA)
  Digestive system
   04970 Salivary secretion
    100064302 (PRKACA)
   04971 Gastric acid secretion
    100064302 (PRKACA)
   04976 Bile secretion
    100064302 (PRKACA)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100064302 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100064302 (PRKACA)
  Nervous system
   04724 Glutamatergic synapse
    100064302 (PRKACA)
   04727 GABAergic synapse
    100064302 (PRKACA)
   04725 Cholinergic synapse
    100064302 (PRKACA)
   04728 Dopaminergic synapse
    100064302 (PRKACA)
   04726 Serotonergic synapse
    100064302 (PRKACA)
   04720 Long-term potentiation
    100064302 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    100064302 (PRKACA)
  Sensory system
   04740 Olfactory transduction
    100064302 (PRKACA)
   04742 Taste transduction
    100064302 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    100064302 (PRKACA)
  Aging
   04211 Longevity regulating pathway - mammal
    100064302 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    100064302 (PRKACA)
  Environmental adaptation
   04713 Circadian entrainment
    100064302 (PRKACA)
   04714 Thermogenesis
    100064302 (PRKACA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100064302 (PRKACA)
   05205 Proteoglycans in cancer
    100064302 (PRKACA)
   05203 Viral carcinogenesis
    100064302 (PRKACA)
  Neurodegenerative diseases
   05012 Parkinson's disease
    100064302 (PRKACA)
   05020 Prion diseases
    100064302 (PRKACA)
  Substance dependence
   05030 Cocaine addiction
    100064302 (PRKACA)
   05031 Amphetamine addiction
    100064302 (PRKACA)
   05032 Morphine addiction
    100064302 (PRKACA)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100064302 (PRKACA)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100064302 (PRKACA)
  Infectious diseases
   05166 HTLV-I infection
    100064302 (PRKACA)
   05169 Epstein-Barr virus infection
    100064302 (PRKACA)
   05165 Human papillomavirus infection
    100064302 (PRKACA)
   05146 Amoebiasis
    100064302 (PRKACA)
  Drug resistance
   01522 Endocrine resistance
    100064302 (PRKACA)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100064302 (PRKACA)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: AGC group
  PKA family
   100064302 (PRKACA)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100064302 (PRKACA)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100064302 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100064302
NCBI-ProteinID: XP_001914812
Ensembl: ENSECAG00000016874
VGNC: 49525
UniProt: F7AI06
Position
7
AA seq 343 aa AA seqDB search
MASNPNDVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGN
HFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMIMEYVPGGE
MFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGF
AKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQ
RKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaccccaacgatgtgaaagagttcttagctaaagccaaagaagattttctt
aaaaaatgggaaaatcctgctcagaatacagcccatttggatcagtttgaacgaatcaag
acccttggcacgggctccttcgggcgggtgatgctcgtgaagcacaaggagacggggaac
cacttcgccatgaagatcctcgacaaacagaaggtggtgaagctgaaacagatcgagcac
accctgaacgaaaagcgcatcttgcaagccgtcaacttcccgttcctcgtcaaactcgag
ttctccttcaaggacaactcgaatctgtacatgatcatggagtacgtgcctggcggggag
atgttctcacacctgcggcggatcggaaggttcagtgagccccatgcccgcttctatgcg
gcccagatcgtgctgaccttcgagtacctgcactcgctcgacctcatctaccgggacctg
aagccggagaacctgctcatcgaccagcacggctacatccaggtgacagacttcggtttc
gccaagcgcgtgaaaggccgcacctggaccttgtgtgggacccccgagtacctggccccg
gaaatcatcctgagcaaaggctacaacaaggctgtggactggtgggccctgggggttctc
atctacgagatggccgctggctacccacccttctttgccgaccagcccatccagatctac
gagaagattgtctccgggaaggtgcggttcccgtcccacttcagctctgacctgaaggac
ctgctgcggaacctcctgcaggtggacctcaccaagcgcttcgggaacctcaagaatggg
gttaatgacatcaagaaccacaagtggtttgccacgactgactggatcgccatctaccag
aggaaggtggaagctcccttcataccaaagtttaaaggccctggggacacgagtaacttt
gacgactatgaggaggaagagatccgagtctccatcaatgagaagtgtggcaaggagttc
tctgagttttag

DBGET integrated database retrieval system