KEGG   Equus caballus (horse): 100064347Help
Entry
100064347         CDS       T01058                                 

Gene name
EEA1
Definition
(RefSeq) early endosome antigen 1 isoform X1
  KO
K12478  early endosome antigen 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04144  Endocytosis
ecb04145  Phagosome
ecb05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100064347 (EEA1)
   04145 Phagosome
    100064347 (EEA1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100064347 (EEA1)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100064347 (EEA1)
 Protein recycling
   Others
    100064347 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE TPR_MLP1_2 zf-Di19 IncA zf-C2H2_4 IBR
Motif
Other DBs
NCBI-GeneID: 100064347
NCBI-ProteinID: XP_023486918
Ensembl: ENSECAG00000007262
VGNC: 17427
Position
28
AA seq 1452 aa AA seqDB search
MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPLCMKRCITAIDLSEHY
QKVHPENESRGQELLNDSSVTGFICPQCMKSLGSADELFKHYQAVHDAGNDSGHGGEALA
LKRDDITLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQESKPDGLVADSSAELQS
LEQKLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEEKSLREAADQKVTHLTEE
LNKAAAVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMTLERERESEKLKDECKKLQ
AESANSEATISQLRSELAKGPQEVAVYVQALQKLKSLVNELTQKNQNLTEKLLKKEVDYT
QLEEKHNEECVSKKNIQANLHQKDLDCQQLQSRLSASESSLQRIQAELGEKGEATQKLKE
ELSEAETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHSKLLETERQLGEAHGRLKE
QRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQHQEQQALQQS
TTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGE
TAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHLRAAQDRVLSL
EASVNELSSQLNESKEKVSQLDIQVKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDK
QQELNKITAQLDQVTAKLQDKQEHCIQLESNLKEYKEKHLSLEQKTEELEGQIKKLEADS
LEVKASKEQALQDLQQERQLNADLELRATELSKQLEVEKEIVSSTKLDLQKKSEAFENTK
QMLTKQEEEKIILKQEIENLSQDAKMQHKELNNKIQTTVTELQKVKMEKETLMTELCAAK
EKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQTESTLKEQSELKKSL
EKEKETSHQLKLELSSMQGQVIQAQNALKQKEKEEQQLQGNMNELKQLTEQKKKQIEALH
GEIKIVTSQKTELENKLQQQSTQAAQELAAEKEKISVLQNTYEKSQENLKQLQSDFYGKE
SELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKTTLEQDSAKKEQQLK
EQCKALQDIQKEKALKEKELVNEKSKLAEIEEIKCRQEKDIAKLSEELKSHKQESIKEVT
NLKDAKQLLIQQKLELQGKVDSLKGALEQEKRNQQMLKEQMKKEEDELKKEFTEKEAKLH
SEIKEKEAGMKKYEENETKLSMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIA
VLEATVQNNQDERRALLERCLKGEGEIEKLQTRVLELQRKLDNTTAAVQELGRENQSLQI
KHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPV
RVCDACFNDLQG
NT seq 4359 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggaggattttacagaggactcctgggagagtgggctctcaaggttctgattta
gattcatcagcaactcctataaacacagtggatgtcaataatgaaagctcctcagagggt
ttcatctgtccgttatgtatgaaaagatgtataactgctattgatttgtcggagcattac
cagaaagtgcaccctgaaaatgaatcaagaggacaggaacttcttaatgactccagtgtt
actggtttcatatgtccccagtgtatgaaatctcttggatctgctgatgaacttttcaaa
cactatcaggcagttcacgatgctggtaatgattcaggtcacggaggagaggctctcgct
ttgaagcgagatgatataacactactcagacaagaggtccaagacctgcaggcttcactt
aaggaagaaaaatggtattcagaggaattaaagaaagaattagaaaaatatcaagggctg
cagcagcaagagtctaaacctgatggattggtggctgattcatcagcagaactacagtct
ttggaacaaaaattagaagaagcccaaacagaaaattttaatattaagcaaatgaaagac
ttatttgaacagaaagcagcccaacttgctactgaaattgcggatataaagtcaaaatat
gatgaagaaaagagtcttcgagaagctgctgatcaaaaggtgacacatctgacagaagaa
ttaaacaaagcagcagctgtaattcaagatctgaagaccgaactgcttcagagacctggt
atagaagatgttgctgtgctaaagaaagaactggtccaagttcaaacactgatggacaac
atgaccttggaacgagagagagaatctgaaaaactcaaagatgagtgcaaaaagttacaa
gcagagtctgctaactccgaggctacaataagccagctaaggagtgaacttgccaaaggc
cctcaggaagttgctgtatatgtgcaggcactacaaaaacttaaaagtttagttaatgaa
ttaacacaaaaaaatcagaacttgactgaaaaactgctgaagaaagaagtggactatact
cagttagaggagaaacataatgaagaatgtgtgagtaaaaagaatatacaagcaaacctt
catcaaaaagacctagattgtcaacagcttcagtcaagattatctgcatctgaaagctcc
ctgcagagaatacaggcagaactaggtgaaaagggagaagctactcaaaagctcaaagaa
gaattatcagaagcagagaccaagtaccagcatcttaaggcagagtttaaacagctacaa
caacagagagaagaaaaagagcagcatgggttacaactccaaagtgagattaatcaatta
catagcaaacttctggagacagagcgccaactaggggaagctcatggtaggctaaaggaa
cagagacagctttcaagtgaaaagctgatggataaagaacagcaggtggctgatctgcaa
ctcaaactttctcgtttagaagaacagttgaaggaaaaagtaacaaattccacagaattg
cagcatcaactagataaaacaaagcagcagcatcaagaacaacaagctcttcaacaaagc
actacagcaaaacttcgagaggctcagaatgatttggaacaagtactacgtcaaattgga
gataaggaccaaaagatccagaaccttgaagccttattacagaagagtaaagaaaatatt
tccttattagaaaaggaaagagaagatctttatgcaaaaattcaggctggtgaaggagag
actgctgttcttaaccagttacaagaaaaaaaccatacattacaggaacaagtaactcaa
ctaacagagaagctgaagaatcagtcagaaagtcataaacaagcccaggagaatttgcat
gaccaggtgcaagagcagaaggcacatcttagagctgcacaagaccgtgtgctttccctg
gaagccagtgtcaatgaattaagtagtcaattaaatgaaagcaaagagaaggtctcccag
cttgacatacaggttaaagccaaaactgaattattgctctcagcagaagcagcaaaaact
gctcaaagagcagatcttcaaaatcatttggacacagcccaaaatgcgttacaagataaa
cagcaggagttaaataagatcactgctcagttggatcaggtcactgcaaagttgcaggat
aagcaagaacattgcattcagctggaaagtaatcttaaagaatataaagagaaacacctc
tctttagaacagaaaactgaagaattagaaggtcaaattaagaaactagaagctgattct
cttgaagttaaagcaagcaaggaacaagctctacaggatctacagcaggagagacagctg
aacgcagatttagagcttagagccacagaactgagcaaacaacttgaagtggagaaagaa
atagtatccagtacaaagttggatctacagaaaaaatctgaagcctttgaaaatactaag
caaatgcttaccaagcaagaggaagaaaaaataatccttaaacaagaaattgaaaattta
agtcaagatgcaaaaatgcagcacaaggaattaaacaacaaaattcaaacaacagtaaca
gaactacaaaaagtgaagatggagaaagagactctaatgacagagctttgtgcagcaaaa
gaaaaattatcaaaagtttctgattctttgaagaactccaaaagtgaatttgaaaaggaa
aatcagaaaggaaaagctgctatattagatttggaaaaaacttgcaaagaattaaagcat
caacttcaagtacagacagaaagcacacttaaggaacagagtgaactgaaaaagtcactt
gaaaaagagaaggagacctctcatcagttgaagttggaactcagttcaatgcagggacaa
gtcatacaagcccagaatgctttaaaacaaaaggaaaaagaagagcaacaactgcagggg
aacatgaatgagctaaagcagctgactgaacagaagaaaaagcaaattgaagccctccac
ggggaaattaaaattgttacttcacagaagacagaacttgagaataaactgcaacagcag
tcaacacaggcggcacaggaactcgcagcagagaaagagaaaatatcagtgttacaaaac
acctatgaaaaaagtcaggaaaatctaaaacagcttcagtctgatttctatgggaaggaa
tctgagcttcttgccacaaggcaagatcttaagtctgtagaggagaagctttctctagca
caggaggacttgatttcaaacagaaatcaaattggaaaccaaaataaattgattcaagaa
ctgaagactgccaagactactttggagcaggattcagcaaagaaagaacagcaattaaag
gagcagtgtaaagcactacaggatattcaaaaagaaaaggcactgaaagagaaagaacta
gtaaatgaaaaatctaaattggcagagatagaggaaattaagtgtagacaagaaaaagac
attgctaaattgagtgaagaactcaagtcccacaagcaggagagcataaaggaggtaaca
aatctcaaggatgccaaacagcttttgattcagcagaaattagagcttcaagggaaagta
gattccctgaagggagcccttgaacaggagaagagaaaccagcaaatgctgaaagagcag
atgaaaaaggaagaagatgagctgaagaaagagtttactgagaaggaagctaaactgcat
tctgaaataaaagaaaaggaagccggaatgaagaagtatgaagaaaatgaaactaaactt
agcatgcagattacagcattaaatgaaaacctgggcactgtaaagaaggagtggcagtcc
agtcaacggagagttagtgagctcgagaagcagacggatgacttacggggtgaaattgca
gtattggaagcaacggttcagaataatcaagatgaaaggagggcactactagaaaggtgt
cttaaaggagaaggtgaaatagaaaagcttcaaaccagagtgctagaattgcagagaaag
ctggacaacacaactgcagcagtgcaggagctgggccgagaaaatcagtcccttcagatc
aaacatacgcaagcgttgaatagaaagtgggcggaagacaatgaagtacaaaactgtatg
gcctgtgggaaaggcttttcagtaacagtaagacggcatcactgcagacaatgtgggaat
atcttctgtgctgaatgttcagccaaaaatgccttaactccttcttccaagaagcctgtt
cgtgtctgtgatgcatgtttcaatgacttgcagggatag

DBGET integrated database retrieval system