KEGG   Equus caballus (horse): 100064425Help
Entry
100064425         CDS       T01058                                 

Gene name
ANXA11
Definition
(RefSeq) annexin A11
  KO
K17095  annexin A7/11
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100064425 (ANXA11)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100064425 (ANXA11)
  Exosomal proteins of other body fluids (saliva and urine)
   100064425 (ANXA11)
  Exosomal proteins of colorectal cancer cells
   100064425 (ANXA11)
  Exosomal proteins of bladder cancer cells
   100064425 (ANXA11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin Ribosomal_S6e
Motif
Other DBs
NCBI-GeneID: 100064425
NCBI-ProteinID: XP_001504073
Ensembl: ENSECAG00000019671
VGNC: 15360
UniProt: F7DE06
Position
1
AA seq 503 aa AA seqDB search
MSYPGFPPPTGGYPPAAPGGGAWGGAGYPPPNMPPIGLDNVANYTGQFNQDYLSGLAANM
SGTFGGANMPNLYPGAPGGGYPPVPPGGFGQPPSTQQPPYGMYPPPGGNPPSGMPSYPPY
PGAPVPGHPMPPPGQQPPGAYPGQPPMTYPGQPPMPPPGQQQQPMPSYPGYSGSGTVTPA
VSPAQFGNRGTITDAPAFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSF
KTAYGKDLIKDLKSELSGNFEKTILALMKTPILFDIYEIKEAIKGAGTDEACLIEILASR
SNEHIRELSRAYKTEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQ
ELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEQGM
LAVVKCLKNTPAFFAERLNRAMRGAGTKDRTLIRIMVSRSEIDLLDIRMEYKRLYGKSLY
HDISGDTSGDYRKILLKICGGND
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagctaccctggctttcccccgcccacaggtggctatcccccagctgcaccaggtggt
ggtgcctggggaggtgctggctaccccccacccaacatgcctcccattgggctggataat
gtggccaactacacagggcagttcaaccaggactacctctcaggactggcagccaacatg
tctgggacattcggaggagccaacatgcccaacctgtaccctggggcccctgggggtggt
taccctccggtgccccctgggggttttgggcaacccccttccacccagcagcctccatat
ggaatgtacccgccccctggaggaaacccaccctccgggatgccttcatatccgccatat
ccaggggctcctgtgccaggccatcccatgccgccccctgggcagcagcccccaggggcc
taccctgggcagccaccgatgacctaccctggacagccaccaatgccacctcctgggcag
cagcagcagcccatgccaagttatccaggatactcagggtccgggactgtcacccctgct
gtgtccccagcccagtttggaaaccgaggcaccatcacagatgctcctgcctttgacccc
ttgcgagatgctgaggtcctgcggaaggctatgaaaggctttgggactgatgagcaggcc
atcattgactgcctggggagtcgttccaataagcagcgacagcagatcctcctgtccttc
aagacagcttatggaaaggatttgatcaaagatctgaaatctgaactgtcaggaaacttt
gagaagacaatcttggctctgatgaagaccccgatcctctttgacatttatgagataaag
gaagccatcaagggggctggcaccgatgaggcctgcctgattgagatcctcgcctcccgt
agcaacgaacacatccgggaattgagcagagcctacaaaacagaattcaaaaagaccctg
gaggaagccattcgaagtgacacatcagggcactttcagcggctgcttatctctctctct
cagggaaaccgggatgaaagcacaaatgtggacatgtcgcttgtccagagagatgtccag
gagctgtatgcagctggggagaaccgcttgggaacagatgagtccaagttcaatgcagtt
ctgtgctcccggagccgggcccacctagtggcagttttcaacgagtatcagcgaatgaca
ggccgagatattgagaagagcatctgccgggagatgtctggggacctggagcagggcatg
ctggccgtggtgaaatgtctcaagaataccccagccttctttgctgaaaggctcaacagg
gccatgaggggagcaggaacaaaggaccggaccctgattcgcatcatggtgtctcgcagc
gagattgaccttctggacatcagaatggaatataagcggctgtatggcaagtcattgtac
cacgacatctcgggagacacttcaggggattaccggaagattttgctgaagatctgtggt
ggcaacgactga

DBGET integrated database retrieval system