KEGG   Equus caballus (horse): 100064939Help
Entry
100064939         CDS       T01058                                 

Gene name
USP34
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 34 isoform X1
  KO
K11853  ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100064939 (USP34)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100064939 (USP34)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100064939 (USP34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 DUF3517 zf-ribbon_3
Motif
Other DBs
NCBI-GeneID: 100064939
NCBI-ProteinID: XP_023474811
Ensembl: ENSECAG00000022272
VGNC: 51423
Position
15
AA seq 3574 aa AA seqDB search
MCENCADLVEVLNEISDIEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKHLEIFN
QVVCALINLVIAQVQVLRDQLCKHCTTVNIDSTWQDENNQVEEPLNIERQCNEGSTERQK
SIEKKSNSTRICNLTEEESSKSSDPFSLWSTDEKEKLLLCVAKIFQIQFPLYTAYKHNTH
PTIEDISTQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPFL
IAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTV
KEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETS
IAKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLKH
CSRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPSVHTEQTLYLASMLIKALWNNALAAKA
QLSKQSSFASLLNTNLPIGNKKEEEELRRAAPSPWSPAASPQSSDNSDTHQSGGSDIEMD
EQLINRTKHVQQRLSDTEESMQGSSDETANSAEDGSSGPGSSSGHSDGSSNEVNSSHASQ
SAGSPGSEVQSEDIADIEALKEEDEDDDHGHNPPKSSCGTDLRNRKLESQAGICLGDSQG
PSERSGTSNGTGKDLVFNTESLPSVDNRIRMLDACSHSEDPENDISGEMNAAHIAQASQE
SCITRTGDFLGETIGNELFNCRQFIGPQHHHHHHHHHHHHDGHMVDDMLSADDVSCSSSQ
VSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHLPNLASIYHEHLSQGPAVHKH
QFNSNAVTDINLDNVCKKGNTLLWDIVQDDDAVNLSEGLINEAEKLLCSLVCWFTDRQIR
MRFIEGCLENLGNNRSVVISLRLLPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLFFDN
LVYYIQAVREGRQKHALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCLVE
DSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNLA
RLATSAYDGGSNSELCGMDQFWGIALRAQSGDVSRAAIQYINSYYINGKTGLEKEQEFIS
KCMESLMIASSSLEQESHSSLTVIERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGISSHL
KALSDKQSLPLRVVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKEQINQQAQLQ
EFGQSSRKGEFPGGLMGPVRMISSGHELTTDYDEKALHELGFKDMQMVFVSLGAPRRERK
GEGVQLPASCLPPPQKDNIPMLLLLQEPHLTTLFDLLEMLASFKPPSGKVAVEDSESLRC
EELHLHAENLSRRVWELLMLLPTCPNMLMAFQNISEEQSNDGLNWKELLKIKSAHKLLYA
LEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQVENSKNSWSCKFVAAGGLQQLLEI
FNSGILEPKEQESWTVWQLDCLACLLKLICQFAVDPSDLDLAYHDVFAWSGIAESHRKRT
WPGKSRKAAGDHAKGLHIPRLTEVFLVLVQGTSLIQRLMSVAYTYDNLAPRVLKAQSDHR
SRHEVSHYSMWLLVSWAHCCSLVKSSLADSDHLQDWLRKLTLLIPETAVRHESCNGLYKL
SLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPIRIDDYEEEPMLKPGCKEYFWLLCK
LVDNIHIKDASQTTLLDLDALARHLADCIRSREILDHQDGNIEDDGLTGLLRLATSVIKH
KPPFKFSREGQEFLRDIFNLLFLLPSLKDRQQPKCKSHSSRAAAYDLLVEMVKGSVENYR
LIHNWVMAQHMQSHAPYKWDYWPHEDVRAECRFVGLTNLGATCYLASTIQQLYMIPEARQ
AVFTAKYSEDMKHKTTLLELQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDMT
EFFTDLITKIEEMSPELKNTVKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMKN
IYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMMK
EKVNTHFSFPLRLDMTPYTEDFLMGKSDRKEGFKEVSDHSKDTESYEYDLIGVTVHTGTA
DGGHYYSFIRDIVNPLAYKNNKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDKF
MDFSFEKTHSAYMLFYKRMEPEEENGKDYKFDVSSELLEWIWHDNMQFLQDKNIFEHTYF
GFMWQLCSCIPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNSQ
AACEWFLDRMADDDWWPMQILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDG
SDDMDASVEDIGGRSCVTRFVRTLLLIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFL
LSLQAISTMVHFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIAL
VALLVEQSRSERHLTLSQTDMAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRL
AEHIVSMLFTSIAKLTPEAANPFFKLLTMLMEFAGGPPGMPPFASYILQRIWEVIEYNPS
QCLDWLAVQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQM
FRSTRSLHIPTRDLPLSPDTTVVLHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYFSFMT
YCLISKTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCADCPENIRLIV
QNPVVTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQW
AFKNLTPHASQYPGAVEELFNLMQLFIAQRPDMREEELEDIKQFKKTTISCYLRCLDGRS
CWTTLISAFRILLESDEDRLLVVFNRGLILMTEMFECLLCARHCARHWGYTSEQDRHGSC
PHNLQSFNTLHMMYHEATACHVTGDLVELLSIFLSVLKSTRPYLQRKDVKQALIQWQERI
EFAHKLLTLLNSYSPPELRNACIDVLKELVLLSPHDFLHTLVPFLQHNHCTYHHSNIPMS
LGPYFPCRENIKLIGGKSNIRPPRPELNMCLLPTMVETSKGKDDVYDRMLLDYFFSYHQF
IHLLCRVAINCEKFTETLVKLSVLVAYEGLPLHLALFPKLWTELCQTQSAMSKNCIKLLC
EDPVFAEYIKCILMDERTFLNNNIVYTFMTHFLLKVQGQVFSEANCANLISTLITNLINQ
YQNLQSDFTNRIEISKASASLNGDLRALALLLSVHTPKQLNPALIPTLQELLSKCRTCLQ
QRNSLQEQEAKERKTKDDEGATPVKRRRVSSDEEHTVDSCISDLKTETREALTPTSTSDN
ETRDSSIIDPGTEQDLPSPENSSVKEYRMEVPSSFSEDIRSQHAEQSNNGRFEDCKEFKD
LPCSKDPNLAEEESEFPSTSISAVLSDLADLRSCDGPALPSQDPEAALSLSCGHSRGLFS
HMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS
NT seq 10725 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgagaactgcgcagacctggtggaggtgttaaatgaaatatcggatatagaaggt
ggtgatggactgcagctcagaaaggaacatactctcaaaatatttgcttatatcaattcc
tggacacagaggcaatgtctgtgctgcttcaaggaatataagcatttggagatttttaac
caagtagtgtgtgcacttattaacttagtgattgcccaagttcaagtgctccgggaccag
ctttgtaaacattgtactactgttaacatagattccacgtggcaagatgagaataatcaa
gtggaagaaccactgaatatagaaagacagtgtaatgaaggaagtacagaaagacaaaaa
tcaatagaaaaaaaatcaaactctacaagaatttgtaatctgactgaggaagaatcttca
aagagttctgatccttttagtttatggagtacggatgagaaggaaaaacttttactatgt
gtggcaaaaatttttcaaattcaatttcccttatatactgcttacaagcataatactcat
cccactatagaggatatatcaacccaagaaagcaacatattaggggcgttctgtgatatg
aatgatgtagaagtaccattgcatttgcttcgttatgtatgtttgttttgtgggaaaaat
ggcctttctctcatgaaggattgctttgaatatggaactcctgaaactttgccatttctt
atagcacatgcatttattacagttgtatctaatattagaatatggctacatatccctgct
gtcatgcagcacattatcccttttaggacctatgttatcaggtatttatgcaagctctct
gatcaagagttaagacagagtgcggctcgcaacatggctgacttaatgtggagcacagtg
aaagaaccattggatacaacgttatgctttgataaagaaagcctagatcttgcatttaag
tactttatgtcacctactttgactatgaggttggctggactaagtcagataacgaatcaa
cttcataccttcaatgatgtgtgcaataatgaatcattggtatcagatacagaaacgtcc
attgcaaaagaacttgcagactggcttataagcaacaatgtggtagagcatatatttgga
ccaaatttacatattgagattatcaaacagtgccaagtgattttgaattttttggcagca
gaagggagactgagtactcaacatattgactgcatttgggccgcagcacagttgaaacat
tgtagtcgatatatacatgatttatttccttcactcatcaagaatttggacccagtacca
cttagacatcttcttaatctggtctcagctcttgagccaagtgttcatactgagcagaca
ttgtacttggcatcgatgttaattaaagcgttatggaataatgcactagcagccaaggct
cagctatctaaacagagttcttttgcatcgttattaaatactaatcttcccattggaaat
aagaaagaggaagaagagctcagaagagcagctccatcaccttggtcacctgcagctagt
cctcaaagcagtgataacagtgatacccatcagagtggaggcagcgacattgaaatggat
gagcaacttattaatagaaccaaacatgtgcaacagcgactttcagacacagaggagtcc
atgcagggaagttctgacgaaactgccaacagtgctgaagatggaagcagtggtcctggt
agcagtagtgggcatagtgatggatctagcaatgaggtgaattctagccatgcaagccag
tcagctgggagccctggcagtgaggtacagtcagaagacattgcagatattgaagccctt
aaagaagaagacgaagatgacgatcatggtcataatcctcctaaaagcagctgtggtaca
gatcttcggaacagaaagttagaaagtcaagcaggcatttgcttaggggattcccaaggc
ccatcagaaagaagtgggacaagcaatggaacaggaaaggacctggtttttaacactgag
tcattgccgtcagtagataatcgaatacggatgctagatgcctgttcacactctgaagac
ccagaaaatgatatttcaggggaaatgaatgctgctcatatagcacaagcatctcaggaa
tcttgtattacacgcactggggactttcttggggagactattgggaatgaattatttaat
tgtcggcagtttattggtccacagcatcatcaccaccaccatcaccaccatcaccatcat
gatgggcacatggtcgatgatatgctaagtgcagatgatgtcagttgcagtagctcccag
gtcagtgcaaaatcagaaaaaaacatggctgattttgatggtgaagaatctggttgtgaa
gaggagctagttcagattaattcacatgcagagctaacatctcatctccaacaacatctt
cccaatttagcatctatttaccatgaacatcttagtcaaggacctgcagttcataaacat
caattcaacagtaatgctgtgacagacattaatttggataacgtttgcaagaaaggaaac
actttgttgtgggatatagtccaagatgatgatgcagttaatctttctgaaggattgata
aatgaggcagagaagcttctctgttccttagtatgttggtttacggatagacagattcga
atgagattcattgaaggttgccttgaaaatttaggaaataacagatcagtagtaatttca
cttcgtcttcttccaaaactgtttggtacttttcagcagtttgggagcagttatgacaca
cattggattacaatgtgggcagaaaaagaactgaacatgatgaagcttttctttgataat
ttggtatactatattcaagctgtaagagaaggaagacaaaaacatgcactgtacagccat
agtgccgaagttcaagttcgacttcagttcttgacttgtgtgttttcaactctgggatca
cctgatcacttcaggttaagtttagagcaagtcgacattttatggcactgcttagtagaa
gattctgagtgttatgacgacgcacttcattggtttttaaatcaagttcgaagtaaagat
caacatgctatgggaatggaaacctacaaacatctttttctggagaagatgccccagcta
aaacctgaaacgattagcatgaccggcttaaacctgtttcagcatctctgtaacttagct
cgattggccaccagtgcctatgatggtggttcgaactctgagctttgtggtatggaccaa
ttttggggcattgctttaagagcacaatctggtgatgtcagtcgagcagctatccagtat
attaactcctattatattaatggtaaaacgggattggagaaggagcaagaatttattagt
aaatgtatggagagtcttatgatagcctctagcagtcttgaacaggaatcacactcaagt
ctcactgttatagaaagaggactccttatgctgaagacacatctggaagcatttagaaga
aggtttgcctatcatctcagacaatggcaaattgaaggcactggtattagtagtcatttg
aaagcactgagtgacaaacagtccctgccgctaagggttgtatgccagccagctggactt
cctgacaagatgactattgaaatgtatcctagtgaccaggtagcagatcttagggctgaa
gtaactcattggtatgaaaatttacagaaagaacaaataaatcaacaagctcagcttcag
gagtttggtcaaagcagccgaaagggagagtttcctggaggccttatgggacctgtcagg
atgatttcatctggacatgagttaacaacagattatgatgaaaaagcacttcatgagctt
ggttttaaggatatgcagatggtatttgtgtctttgggtgcaccaaggagagaacggaaa
ggggaaggtgttcagctgccagcgtcctgcctaccaccccctcagaaggacaacattcca
atgcttttgcttttacaagaacctcatttaactactctttttgatttattagagatgctt
gcgtcatttaaaccaccctcaggaaaagtggcagtggaagacagtgagagcttaagatgt
gaagaacttcatcttcatgcagaaaatctctctaggcgtgtatgggagctactgatgctt
cttcctacatgccctaacatgttgatggcgttccagaatatctcagaggaacagagtaat
gatggacttaattggaaagaactgctcaaaattaagagtgctcacaagctattatatgcc
ctggaaattattgaagcactgggaaaacctaacagaagaataaggagagaatcaacgggg
agttacagtgatctttatccagattcagatgattcaagtgaggatcaagtggaaaatagt
aaaaattcctggagttgcaagtttgttgctgccggagggcttcaacagttattagaaatt
tttaattctggaattttggagcctaaggagcaggaatcttggactgtgtggcagctagac
tgtcttgcttgcttgctgaagttaatatgccagtttgcagtagatccgtctgatttggat
ttagcttatcatgatgtctttgcctggtctggtatagcagaaagccataggaaaagaacc
tggcctggcaaatcaagaaaggctgctggtgatcatgccaagggtcttcatataccaaga
ttaacagaggtatttcttgttcttgtccaaggaaccagtttgattcagcgacttatgtct
gttgcttatacgtatgataatctggctcctagagttttgaaagctcagtctgatcacagg
tctagacatgaagtttcacattattcaatgtggctgttggtgagttgggctcattgctgt
tctttagtgaaatctagccttgctgatagtgatcatttacaagattggctaaggaaattg
accctccttattcctgagactgcagtccgtcatgagtcttgcaatggtctttataagtta
tctctgtcagggctggatggaggagactcaatcaatcgctcttttctgctattggctgcc
tcaacattgttgaaatttcttcctgatgctcaagcactcaaacctatcaggattgatgat
tatgaagaagaaccaatgttaaaacctggatgtaaagagtatttttggttgttgtgcaaa
ttagttgacaacatacatataaaggatgctagtcagacaacactcctcgacttagatgct
ttggcacgacatttggctgactgtattcgaagcagagagatccttgatcatcaagatggt
aatatagaagatgatgggcttacgggactcctaaggctcgcaactagtgttatcaaacac
aaaccaccctttaaattttcaagggaagggcaggaatttttaagagatatcttcaatctc
ctgtttttgttgcctagtctgaaagatagacaacagccaaagtgtaaatcgcattcttca
agagctgctgcttatgatttgttagtagagatggtaaagggatctgttgagaactacagg
ctaatacacaactgggttatggcacaacacatgcagtcccatgcaccttataaatgggac
tactggcctcatgaggatgtccgtgctgagtgtagatttgttggcctgaccaaccttgga
gctacttgttacttggcatctactattcagcaactttatatgatacctgaagcaagacag
gctgtcttcactgctaagtattcagaagatatgaagcacaagaccactctactggagctt
caaaaaatgtttacatatttaatggagagtgaatgcaaagcatataatcctagacctttc
tgcaaaacatataccatggataagcagcctttgaatactggggagcagaaagatatgaca
gagttttttactgatctgattaccaaaattgaagaaatgtctccagaactgaaaaatacc
gtcaaaagtttgtttggaggtgtaattacaaacaatgttgtgtccttggattgtgagcat
gttagtcagactgctgaagagttttatactgtgaggtgccaggtggctgatatgaagaac
atttatgaatctcttgatgaagttactattaaagacaccttagaaggtgacaacatgtat
acttgttctcattgcgggaagaaagtacgagctgaaaaaagggcatgttttaagaaattg
cctcgcattctgagtttcaatactatgcgatatacatttaatatggtcacaatgatgaaa
gagaaagtgaacacacacttttctttcccattacgtttggatatgacaccctatacagaa
gattttcttatgggaaagagtgacaggaaagaaggttttaaggaagtcagtgatcattca
aaagacacagagagctatgagtatgatttgataggagtgactgttcacacaggaacagca
gacggtgggcactattatagcttcatcagagatatagtcaatccacttgcttataaaaac
aataaatggtatctttttaatgatgctgaggtaaaaccttttgattctgctcaacttgcc
tctgaatgttttggtggagagatgacaaccaagacctatgattctgttacagataaattt
atggacttctcctttgaaaagacacacagtgcatatatgctgttttacaaacgcatggaa
ccagaggaagaaaatggcaaagactacaaatttgatgtttcctcagagttactagagtgg
atttggcatgataacatgcagtttcttcaagacaaaaacatttttgaacatacatatttt
gggtttatgtggcagttgtgtagttgcattcccagtacattaccagatcctaaagctgtg
tctctgatgacagcaaagttaagcacttcctttgttttagagacatttatacattcaaaa
gaaaagcccacaatgcttcagtggattgaactgttgaccaaacaatttaataatagtcaa
gcagcttgtgagtggtttttggaccgcatggctgatgatgactggtggccaatgcagata
ctaattaagtgccctaatcaaattgtgagacagatgtttcagcgtttgtgtatccatgtg
attcagagacttagacctgtacacgctcatctctatctacagccaggaatggaagatggg
tcagatgacatggatgcctcagtagaagatattggtggtcgttcatgtgtcactcgattt
gtgagaactctgttattaattatggaacatggtgtaaaacctcacagtaaacatcttaca
gagtattttgccttcctttatgagtttgccaaaatgggtgaagaagagagccagtttttg
ctctcattgcaagccatatctacaatggtacatttttacatgggaaccaaagggcctgaa
aatcctcaagttgaagtgttatcagaggaagaaggagaagaagaggaagaagaagaagat
atcctctctctggcagaagaaaaatacaggccagctgcccttgaaaaaatgatagcttta
gttgctcttttggttgaacaatctcgctcagaaaggcatttgacgttatcacagactgac
atggcagcattaacaggaggaaagggatttcccttcttgtttcaacatattcgtgatggc
atcaatataagacaaacatgtaatctgattttcagcctatgtcgatacaataatcgactt
gcagaacatattgtatctatgcttttcacatcaatagcaaaattgactcctgaggcagcc
aatcctttctttaaattgttgactatgctaatggagtttgctggtggacctccaggaatg
cctccctttgcgtcttacattctacagaggatatgggaggtaattgaatacaatccttct
cagtgtctggattggttggcagtgcagacaccccgaaataaactggcacacagctgggtc
ctacagaatatggaaaactgggttgagcggtttcttttggctcacaattaccctagagtc
agaacttctgcagcttatcttctggtgtcccttataccaagcaattcattccgccagatg
ttccggtcaacaaggtctttgcacatcccaacccgtgaccttccactcagtccagacaca
acagtagtcctacatcaggtctacaacgtgctccttggtttgctctcaagagccaaactt
tatgttgatgctgctgttcatggcactacaaagctagtgccctattttagctttatgact
tactgtttaatttccaaaactgagaagctgatgttttccacatatttcatggatttgtgg
aaccttttccagcctaaactttctgagccagcaatagctacaaatcacaataaacaggct
ttgctttcattttggtacaatgtgtgtgctgactgtccagagaatatccgccttattgtt
cagaacccagtggtaaccaagaacattgccttcaattacatccttgctgaccatgatgat
caggatgtggtgctttttaaccgtgggatgctgcctgcctactacggcattctgaggctc
tgctgtgagcagtctcctgcattcacacgacaactggcttctcaccagaacatccagtgg
gcctttaagaatcttacaccacatgccagccaataccctggagcagtggaagaactgttt
aacctgatgcagctatttatagctcagcggccagatatgagagaagaagaattagaagat
attaaacagtttaagaaaacaaccataagttgttatttacgttgcttagatggccgctcc
tgctggactactttaataagtgccttcagaatactactagaatctgatgaagacagactt
cttgttgtatttaatcgagggttgatcctgatgacggagatgtttgaatgtctactctgt
gccaggcattgtgctaggcactggggatacaccagtgaacaagacagacatggttcctgt
cctcacaacttacagtcattcaacacactgcatatgatgtatcatgaagccacagcttgc
catgtgactggagacttagtagaacttctgtcaatattcctttcggttttgaagtctaca
cgcccatatcttcagagaaaagatgtgaaacaagcattaatccagtggcaggagcgaatt
gaatttgcccataaattgttaactcttcttaattcctatagcccgccagaacttagaaat
gcctgtatagatgtcctcaaggaacttgtgcttttgagtccccatgactttcttcatact
cttgttccatttctacaacacaaccattgtacttaccatcacagtaatataccaatgtct
cttggaccttatttcccttgtcgagaaaatatcaagctaataggagggaaaagcaatatt
cggcctccgcgccctgaactcaatatgtgcctcttgcccacaatggtggaaaccagtaag
ggcaaagatgacgtttatgatcgtatgctgctagactacttcttttcttatcatcaattc
atccatctattatgccgagttgcaatcaactgtgaaaaatttactgaaacattagttaag
ctgagtgtcctagttgcctatgaaggtttaccacttcatcttgcactgttccccaaactc
tggactgagctatgccagactcagtctgctatgtcaaaaaattgcatcaagcttttgtgt
gaagatcccgtttttgcagaatatataaaatgtatcctaatggatgaaagaacttttcta
aacaacaacattgtctacacattcatgacacattttcttctaaaggttcaaggtcaagtg
ttttctgaagcaaactgtgccaatttgattagcacccttattacaaacttgataaatcag
tatcagaatctacagtctgatttcaccaaccgaattgaaatttccaaagcaagtgcttct
ttaaatggggacctgcgggcacttgctttgctcctgtcggtacacactcccaaacaatta
aacccagctctaattccaactctgcaagagcttttaagcaaatgcaggacttgtctgcag
cagagaaactcactccaagagcaagaagccaaagaaagaaaaactaaagatgatgaaggg
gcgactcctgttaaaaggcggcgtgtgagcagtgatgaggagcatactgtagacagctgc
atcagcgacctgaaaacagaaaccagggaggccctgaccccaaccagcacttcagacaac
gagacaagagactcctcaattatcgatccaggaactgagcaagatcttccctcccctgaa
aatagttctgttaaagaataccgaatggaagtcccatcttcgttttcagaagacatcagg
tcacagcatgcagaacagtccaacaatggtagatttgaagactgtaaagaatttaaagac
ctcccctgttccaaggatcctaacctagctgaggaagagtctgagttcccttctacttct
atctctgcggttctgtctgacttagctgacttgagaagttgtgatggtccagctttgccc
tcccaggaccctgaggctgctttatcactcagttgtggccattccagaggactctttagt
cacatgcagcaacacgacattttagataccctgtgtaggaccattgaatctacgatccat
gtggtcacaaggatatctggcaaaggaaatcaagctgcttcttga

DBGET integrated database retrieval system