KEGG   Equus caballus (horse): 100065024
Entry
100065024         CDS       T01058                                 

Gene name
TECR
Definition
(RefSeq) very-long-chain enoyl-CoA reductase isoform X4
  KO
K10258  very-long-chain enoyl-CoA reductase [EC:1.3.1.93]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100065024 (TECR)
   01040 Biosynthesis of unsaturated fatty acids
    100065024 (TECR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100065024 (TECR)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.93  very-long-chain enoyl-CoA reductase
     100065024 (TECR)
Lipid biosynthesis proteins [BR:ecb01004]
 Fatty acid synthase
  Component type
   100065024 (TECR)
SSDB
Motif
Pfam: Steroid_dh ubiquitin
Other DBs
NCBI-GeneID: 100065024
NCBI-ProteinID: XP_001498421
Ensembl: ENSECAG00000018572
VGNC: 23985
UniProt: A0A5F5PGU0
Position
7
AA seq 308 aa
MKHYEVEILDAKTREKLCFLDKVEPQATIAEIKNLFTKSHPQWYPARQSLRLDPKGKSLK
DEDVLQKLPVGTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGHRYDFT
SSRHTVVHLACICHSFHYVKRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYIN
HPLYTPPTYGAQQVKLALAIFVICQLGNFSIHMALRDLRPAGSKTRKIPYPTKNPFTWLF
LLVSCPNYTYEVGSWIGFAIMTQCLPVALFSLVGFTQMTIWAKGKHRSYLKEFRDYPPLR
MPIIPFLL
NT seq 927 nt   +upstreamnt  +downstreamnt
atgaagcactacgaggtggagattctggatgcgaagacgcgggagaagctgtgtttcctg
gacaaggtggagccccaggccaccattgctgagatcaagaacctcttcaccaagagccat
ccgcagtggtaccctgcccgccagtccctccgcctggaccccaagggcaagtccctgaag
gatgaggatgtcctgcagaagctgcctgtgggcaccacggccacactctacttccgggac
ctgggggcccagatcagctgggtgacggtcttcctgacagagtacgcggggcccctcttc
atctatctgctcttctacttccgggtgcccttcatctatggccacagatatgacttcacg
tcaagccggcacacggtggtgcacctggcctgcatctgccactcatttcactacgtcaag
cgcctgctggagacactcttcgtgcaccgcttctcccacggcaccatgcccttgcgcaac
atcttcaagaactgcacttactactggggcttcgctgcgtggatggcctattacatcaac
caccctctctacacgccccccacctacggggctcagcaggttaaactggcgctcgccatc
tttgtgatctgccagcttggcaacttctccatccacatggccctgcgcgacctgcggcca
gctgggtccaagaccaggaagatcccataccccaccaagaaccccttcacgtggctcttc
ctgctggtgtcctgccccaactacacttatgaggtggggtcctggatcggctttgccatc
atgactcagtgtctcccagtggccctcttctccctggtgggcttcacccagatgaccatc
tgggccaagggcaagcaccgcagctacctgaaggagttccgcgactacccgcccctgcgc
atgcccatcatccccttcctgctctga

DBGET integrated database retrieval system