KEGG   Equus caballus (horse): 100065395Help
Entry
100065395         CDS       T01058                                 

Gene name
USP44
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 44
  KO
K11834  ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100065395 (USP44)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100065395 (USP44)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100065395 (USP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH zf-UBP UCH_1
Motif
Other DBs
NCBI-GeneID: 100065395
NCBI-ProteinID: XP_014592243
Ensembl: ENSECAG00000010123
VGNC: 24846
Position
28
AA seq 712 aa AA seqDB search
MLTMDKCKHIGQLRLAQDHSILNPQKWHCVDCNTTESIWACLSCSHVACGRYIQEHALRH
FQESSHPVALEVNEMYVFCYFCDDYVLNDNATGDLKLLRSTLSALKSQNYHCPTGSGRVL
RSAGTRDDSYFLHDGAQSLLENEDQMSTAVWHRRRILMGKIFRTWFELSPIGRKRQEEQF
QEKIAAKREVKKRREELEYEVKAELESMPPRKSLRLQGLAQSTTLGIVPVQVPLPTPASP
AKDKVLSTSEDVRLRKASDFSVKRTLVVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQC
FLNLDLNRWLAVTASDKTRSSYKRLPATDTVYQMNEYQEKDTGSFRSRRPSLSLGLSGGA
SKSRKMELIQLREPSSQCISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYA
QQDAQEFLCELLDKIQHELETTGTSLPALIPTSQRKAIKQVLNVVNNIFHGQLLSQVTCL
ACDNKSNTIEPFWDLSLEFPERYQYSGKDTAAQPCLVTEMLAKFTETEALEGKIYICDQC
NSKRRRFSSKPVVLTEAQKQLMICHLPQVLRLHLKRFRWSGRNNREKIGVHVGFEEILNM
EPYCCRDSLKSLSPECFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMC
TMDEVCKAQAYILFYTQRVTENGRPKLLPPELLSGSQHPSEEADPSSNEIFS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaatggataagtgcaaacacattggtcagttgcggcttgctcaagaccattcc
atcctcaaccctcagaaatggcattgtgtggactgcaatacaactgagtcgatttgggct
tgccttagctgttcccatgttgcctgtggaagatatattcaagaacatgcactcaggcac
tttcaagaaagcagtcatcctgttgcattggaggtgaatgagatgtatgttttttgttac
ttttgtgatgattatgttcttaatgataacgcaactggagacctgaagttactacgaagt
acgttaagtgcgctcaagagtcagaattatcactgccccactgggagcggaagggtctta
cggtctgcgggtacacgcgatgactcttatttcttacatgatggcgcccaatctctgctt
gagaatgaagatcagatgtctactgctgtctggcaccggagaaggatactaatgggtaaa
atctttcgaacttggtttgaactatcacccattggaagaaaaaggcaagaagaacaattt
caggaaaaaatagcagcaaaaagagaagtgaagaaacgacgggaagaattagagtatgaa
gttaaagcagaattggaaagtatgcctccaagaaagagtctacgtttgcaaggtctagcc
cagtccaccacactaggaatagttcctgttcaagtaccgctaccaaccccagcctcacca
gcaaaagataaagtattatctacctcagaagatgtaagattaagaaaagccagtgacttc
tcagttaaacgaacactagtagtaactcctggtgtaacgggattgagaaatttgggaaat
acttgctacatgaattctgttcttcaggtgttgagtcatttacttatttttcgacaatgt
tttttaaatcttgatctgaaccgatggctggccgtgacagctagtgataagacaagatca
tcttataagcgtctaccagccaccgataccgtatatcaaatgaacgaataccaagaaaaa
gatacaggatcttttcgctccagacgtccaagtttatcattaggactaagtggtggagca
tcaaagagtagaaagatggaacttattcagctgagggagccaagttcacaatgcatttct
ctctgtcatgaattgcatactttgttccaggtcatgtggtctggaaagtgggccttggtc
tcaccatttgccatgctacactcagtgtggagactaattcctgcttttcgtggttatgct
caacaagatgctcaggaatttctttgtgaacttttggataaaatacaacatgaactagag
acaactggtaccagtttaccagctcttatccccacttctcaaaggaaagctatcaaacag
gttctgaatgttgtgaataacatttttcatggacaacttcttagtcaggttacatgtctg
gcgtgtgacaacaaatcaaataccatagaacctttctgggacttgtcactggaatttcca
gaaagataccagtacagtggaaaagatactgctgcccagccatgtctggtgactgaaatg
ttggccaaattcacagaaactgaagctttagaaggaaaaatctacatatgcgaccagtgt
aactcaaagcgtagaaggttttcctcaaaaccagttgtcctcacagaagcccaaaagcag
cttatgatttgccacctgcctcaggtgctcagactacatctcaaacgattcaggtggtca
ggacgtaacaaccgagagaagattggcgttcatgttggctttgaagaaatcttaaacatg
gagccctattgctgcagggactccctgaaatccctcagcccagaatgctttatctatgac
ttatctgctgtggtaatgcaccatgggaaaggattcggctcaggacactacactgcctac
tgctacaactctgaaggagggttttgggtacactgcaatgattccaagctaagcatgtgc
actatggacgaagtctgcaaggcccaggcttatatcttgttttacacccagcgagtcact
gagaacgggcgtcctaaactcctgcctccagaactcctgtctggtagccagcatcccagt
gaagaagctgatccctcttctaatgaaatctttagctga

DBGET integrated database retrieval system