KEGG   Equus caballus (horse): 100066401Help
Entry
100066401         CDS       T01058                                 

Gene name
CNP
Definition
(RefSeq) 2',3'-cyclic-nucleotide 3'-phosphodiesterase isoform X2
  KO
K01121  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100066401 (CNP)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     100066401 (CNP)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   100066401 (CNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNPase AAA_33 6PF2K AAA_16 Zeta_toxin AAA_22 KTI12 ABC_tran AAA_30 AAA AAA_18 AAA_5 NACHT CPT AAA_17 AAA_14
Motif
Other DBs
NCBI-GeneID: 100066401
NCBI-ProteinID: XP_005597449
VGNC: 16683
Position
11
AA seq 400 aa AA seqDB search
MSSSGAKDKPELQFPFLQDEETVSALHECKTLFILRGLPGSGKSTLARVILDRYRDGTKL
VSADSYKITPGARGAFSEEYKRLDEDLAAYCRRDTRVLVLDDTNHERERLEQLFEMADQY
QYQVVLVEPKTSWRLDCTLLKEKNQWQLSADELKKLKPGLEKDFLPLYFGWFLTKKSSES
LRKAGQAFLEELGNHKAFKKELRQFVPGDEPREKIELLTYFGKRPPGVLHCTTKFCDYGK
AAGAEEYAQQDAVKKAYGKAFMLTISALFVTPKTTGARVELSEQELLLWPNDVDKLSPSD
SLPRGSRAHITLGCAADVEAVQTGIDLLEIVRQEKGGNRGEEVGELNRGKLYSLGSGRWM
LNLAKKMEVRAIFTGYYGKGKPVPIQGSRKGGAFQSCTII
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcctcaggggccaaggacaagcctgagctgcagtttcccttcctgcaggatgag
gagacggtgtccgcactgcatgagtgcaagacactcttcatcctgcgcggcctgccaggg
agtggcaagtccacgctggcacgggtcatcctggacaggtaccgtgacggcaccaagttg
gtgtctgccgacagttacaagatcacccctggtgctcgaggagccttttccgaggagtac
aagcggctggacgaggacctggctgcctactgccgccgggacacccgagtccttgtgctg
gatgacaccaaccatgagcgggagcggctggagcagctctttgaaatggccgaccagtac
cagtaccaggtggtgctggtggagcccaagacgtcgtggcggctggactgtaccctgctt
aaggagaagaaccagtggcagctgtcagctgatgagctgaagaagctgaaacctgggctg
gagaaggacttcctgccactctacttcggctggttcctgaccaagaagagttctgagagc
ctccgcaaagctggccaggccttcctggaggagctggggaaccacaaggccttcaagaag
gagctgcgacagttcgtccctggggatgagcccagggagaagattgaactgctcacctac
tttgggaagagacccccaggtgtgctacactgtacaaccaagttctgcgactacgggaaa
gccgccggggcagaggagtacgcccagcaggatgcagtaaagaaagcttacggcaaggcc
ttcatgctgaccatctctgccctctttgtgacaccgaagacgactggagcccgggtggag
ctgagtgagcaggagctgctgttgtggccaaatgatgtggacaagctgtcaccctctgac
agcctgccccgggggagccgtgctcacatcaccctgggctgtgcggctgacgtggaggcc
gtgcagacaggcattgacctcctagagattgtgcggcaggagaaggggggcaaccgaggt
gaggaggtgggtgagctaaaccggggcaagctctactccttgggcagtgggcgctggatg
ctgaacctggccaagaagatggaggtcagggccatcttcacagggtactacgggaagggc
aaacctgtgcccatacaaggcagccgaaaggggggtgcctttcagtcttgcaccatcatt
tga

DBGET integrated database retrieval system