KEGG   Equus caballus (horse): 100066472Help
Entry
100066472         CDS       T01058                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B31 isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00040  Pentose and glucuronate interconversions
ecb00053  Ascorbate and aldarate metabolism
ecb00140  Steroid hormone biosynthesis
ecb00830  Retinol metabolism
ecb00860  Porphyrin and chlorophyll metabolism
ecb00980  Metabolism of xenobiotics by cytochrome P450
ecb00982  Drug metabolism - cytochrome P450
ecb00983  Drug metabolism - other enzymes
ecb01100  Metabolic pathways
ecb05204  Chemical carcinogenesis
Module
ecb_M00014  Glucuronate pathway (uronate pathway)
ecb_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100066472
   00053 Ascorbate and aldarate metabolism
    100066472
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100066472
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100066472
   00860 Porphyrin and chlorophyll metabolism
    100066472
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100066472
   00982 Drug metabolism - cytochrome P450
    100066472
   00983 Drug metabolism - other enzymes
    100066472
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100066472
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100066472
Glycosyltransferases [BR:ecb01003]
 Others
  Hydrophobic molecule
   100066472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 100066472
NCBI-ProteinID: XP_001501836
Position
3
AA seq 530 aa AA seqDB search
MSMKWISVLLLLLQSSYLSPGNAGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSA
SILVDPNKPSAIKFEIYPTSLRKHDFEGFFTKVIDKWIYKLSKYTFWTYFSLMQEIFGEF
SDCMEKLCKDAVLNKKLTTKLQESKFDVVLADAVGPCGELLAEILKIPLVYSLRFLPGYK
TEKRSGGLPFPPSYVPVVLSELSDQMTFLERVKNMMYLLYFDFWFQTVKEANWDQFYSEV
LGRPTTLSELMGKAEIWLIRTYWDFEFPRPLLPHFEFVGGLHCKPAKPLPKEMEELAQSS
GENGIVVFTLGSMVSNMTEERANVIASALAQIPQKVIWRFDGKKPDTLGPNTRLYKWIPQ
NDLLGHPKTKAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKTKGAAVRLDFNT
MTSTDLLNALKIVINDPFYKENAMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRPA
SYSLTWYQYHSLDVIGFLLACVATTIFVITKCCLFCCHKLANTGKKEKRE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaatggatttcagttctgctgctgctactgcagagttcttacttgagccct
gggaatgctggaaaggtgctggtgtggcccacagaatacagccactggatcaatatgaag
acaatcctggaagaacttgtccagagaggtcatgaagtgactgttctgacgtcttcagct
tccattcttgttgatcccaacaaaccatctgctattaaatttgagatttatcctacatct
ttaagaaaacatgattttgagggttttttcacaaaagtaattgacaaatggatatataaa
ctgtcaaaatacacattttggacatacttttcactaatgcaagaaatctttggggaattt
tctgattgtatggaaaagctctgtaaagatgcagttttgaacaagaaacttacaacaaaa
ctacaagaatcaaagtttgatgttgttctcgcagatgccgttgggccctgtggtgagctg
ctggctgagatattgaaaatacctctagtgtacagtctccgcttcctcccaggctataaa
actgaaaaacgtagtggaggacttccattccctccgtcgtacgtaccagttgttctgtca
gaattaagtgatcaaatgacattcttggagagggtaaaaaatatgatgtatttgctttat
tttgacttttggttccaaacagttaaggaagcaaattgggatcagttctacagtgaagtg
ctaggaagacccactacattatctgagttaatggggaaggctgaaatctggctcattcga
acctattgggattttgaatttcctcgtccactcttacctcattttgaatttgttggagga
ctccactgcaaacctgctaaacccctgcctaaggaaatggaagagcttgcccagagctct
ggagaaaatggtattgtggtgtttactctggggtcaatggtcagtaacatgacagaagaa
agagccaatgtgattgcatcagcccttgcccagattccacaaaaggtgatatggagattt
gatggcaagaaaccagataccttagggccaaacactcggctctataagtggatcccccag
aatgaccttcttggtcatccaaaaaccaaagcctttataactcatggtggagccaacggc
atctatgaggcgatctaccatgggatccctatggtaggcattcccttgtttgcggatcaa
cctgataatattgctcacatgaagaccaagggagcagccgttagactggacttcaacaca
atgacaagtacagatttgctcaatgcattgaagatagtcattaatgacccattctataaa
gagaatgctatgaaattatcaagaattcaacatgatcaaccagtgaagcctctagatcga
gcagtcttctggatcgagtttgtcatgcgccacaaaggagccaaacacctgcggccagcc
tcctacagtctcacctggtaccagtaccactctttagatgtgattggcttcttgctggcc
tgtgtggcaactactatatttgtcatcacaaaatgttgtctgttttgttgccataagctt
gctaacacaggaaagaaggaaaaaagggaatag

DBGET integrated database retrieval system