KEGG   Equus caballus (horse): 100066518Help
Entry
100066518         CDS       T01058                                 

Gene name
USP49
Definition
(RefSeq) LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 49
  KO
K11834  ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100066518 (USP49)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100066518 (USP49)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100066518 (USP49)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH zf-UBP UCH_1
Motif
Other DBs
NCBI-GeneID: 100066518
NCBI-ProteinID: XP_023480683
Ensembl: ENSECAG00000018640
VGNC: 24849
Position
20
AA seq 681 aa AA seqDB search
MDRCKHVGRLRLAQDHSILNPQKWCCRECTTTESVWACLKCSHVACGRYIEDHALKHFEE
TGHPLAMEVWDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQKQDLPVRRGRMLRSM
AAGEDAIPLQHAPQGQPQMLTALWYRRQRLLAKTLRLWFEKSSRGQAKLEQRRQEEALER
KKEEARQRRREVKRRLLEELASAPPRKSARLLLHAPRAAAPRPASPRAPAGAASSXRRAP
AMAPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFLNLDPSKTEHLFPKTNGKAPLSGRP
ASSSATELSARSDRAESGEREGLCLNGGASISRSLELIQNKEPSSKHISLCHELHTLFRV
MWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGTTHRILIP
FSQRKLTKQVLKVVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYHCIEKGFI
PLNQTECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQLMIYRLPQ
VLRLHLKRFRWSGRNHREKIGVHVVFDQVLTMEPYCCRDMLSSLDKETFAYDLSAVVMHH
GKGFGSGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQGNARISE
TQLQAQVQSSNNDEGRPRTFP
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggatagatgcaaacatgtagggcggttgcggctcgcccaggaccactccatcctgaac
cctcagaagtggtgctgcagggagtgcaccaccaccgagtccgtgtgggcttgtctcaag
tgctcccacgtggcctgcggccggtacattgaggatcacgcccttaaacactttgaggag
actggacacccccttgccatggaggtctgggatctctacgtgttctgttacctgtgcaag
gactatgtgctcaatgataacccggagggggacctgaagctgctgagaagctccctcttg
gccgtcaggggccagaagcaggacctgccggtgaggcgcgggcggatgctgcggtccatg
gccgcgggcgaggacgccatcccgctgcagcatgcccctcagggacagccgcagatgctc
acggctctgtggtaccggcgccagcgcctgctggccaagacgctgcggctctggttcgag
aagagctcccggggccaggcgaagctggagcagcggcggcaggaggaggcgctggagcgc
aagaaggaggaggcgcggcagcggcggcgcgaggtgaagcggaggctgctggaggagctg
gccagcgcccctccgcgcaagagcgcgcgcctgctgctgcacgcgccccgggccgcggcc
ccgcgccccgcctcgccgcgcgcgcccgccggggccgcctccagcncgcgccgcgccccc
gccatggcgcccggcgtcacgggcctgcgcaacttgggcaacacctgctacatgaactcc
atcctccaggtgctcagccacctccaaaagttccgagagtgttttctgaacctcgaccct
tccaaaacggaacacctgtttcccaaaaccaacgggaaggctccactgtcgggcaggccg
gccagcagctcggccactgagctgtctgcgaggagcgacagggctgagtcgggcgagcgg
gagggcctctgcttgaacggcggggcctccatcagccggagcctagaactcatccagaac
aaggagccgagctcgaagcacatttccctctgtcacgaactgcacaccctcttccgagtc
atgtggtctggcaagtgggccctggtgtcacccttcgccatgcttcactcagtgtggagc
ctgatccctgccttccgcggctacgaccagcaggacgcgcaggaatttctctgcgagctg
ttgcacaaagtgcagcaggaactcgagtccgagggcaccacgcaccggatcctcatcccc
ttctcccagaggaagctcaccaaacaggtcttaaaggtggtgaataccatatttcacggg
cagctacttagtcaggtcacatgtatatcatgcaattacaaatccaataccattgagccc
ttttgggatctgtccctggaattccctgaacgctatcactgcatagaaaaggggtttatc
cctttgaatcagacagagtgcctgctcactgagatgctggccaagttcacagaaacagag
gccctggaagggagaatctacgcttgtgaccagtgtaacagcaaacgacgaaaatccaat
ccaaaaccccttgttctgagtgaagctagaaaacagttaatgatctacagactacctcag
gtcctccggctgcaccttaaaagattcaggtggtctggccgtaatcatcgagagaagatt
ggggtccatgtcgtctttgaccaggtattaaccatggaaccttactgctgcagggacatg
ctctcctctcttgacaaagagacctttgcctatgatctctccgcagtggtcatgcatcac
gggaaagggtttggctcaggacactacacagcctattgctacaacacagagggaggtttt
tgggtccactgcaatgactcaaagctgaatgtatgcagtgtcgaggaagtgtgcaaaact
caagcctacatccttttttacactcaaagaacagttcagggcaatgcaagaatctcagaa
acccaactccaagctcaggtgcagtccagcaacaacgatgagggcagaccacggaccttc
ccctga

DBGET integrated database retrieval system