KEGG   Equus caballus (horse): 100066657Help
Entry
100066657         CDS       T01058                                 

Gene name
BARHL1
Definition
(RefSeq) barH-like 1 homeobox protein
  KO
K09360  BarH-like
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100066657 (BARHL1)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    100066657 (BARHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 100066657
NCBI-ProteinID: XP_001917858
Ensembl: ENSECAG00000021032
VGNC: 15766
UniProt: F6W4G4
Position
25
AA seq 327 aa AA seqDB search
MEGSNGFGIDSILSHRAGSPALPKGDPLLGDCRSPLELSPRSESSSDCSSPASPGRDCLE
TGASRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQP
AAPEPGGRLVAKAAEDFRDKLDKSGSNVSSDSEYKVKEEGDREISSSRDSPPVRLKKPRK
ARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVG
LELLAEAGNYSALQRMFPSPYFYPQSLVSNLDPGAALYLYRGPSAPPPALQRPLVPRILI
HGLQGASEPPPPLPPLAGVLPRAAQPR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaaggctccaatggctttgggatcgactccattctctcccaccgcgcgggcagcccc
gcccttcccaagggggaccccttgctcggggactgccgctcgcccctggaactgagtccg
cgctcggagagcagcagtgactgctcttcaccagcctcgccaggaagggactgtctggag
acgggtgcctcgcggcctggtggggcatcgggcccaggtttggactctcacctgcagcct
gggcagctctcagccccagcccagtcgcgcactgtgacctcctcctttctgatcagggac
atccttgctgactgcaaaccactcgcagcctgtgcaccctactctagcagtgggcagccg
gccgcccctgagcctgggggccgtcttgtggccaaggccgcggaggactttagagacaag
ctggacaaaagtggcagcaacgtctcgtcggactctgagtataaagtgaaggaggagggt
gaccgcgagatctccagctcgagggacagtcccccggtgcgcctgaaaaagccacgcaag
gcacgcacggccttcaccgaccatcagctggcacagctggagcgcagcttcgagcggcag
aaatacctgagcgtgcaggaccgcatggagctcgccgcctcactcaacctcaccgacacg
caggtcaagacctggtaccagaaccgcaggactaaatggaagcgacagacagccgtcggg
ttggagctgctggcggaagcaggcaattactcagcgctccagcggatgttcccgtcgcct
tatttctacccgcagagtctagtttccaacctggatcccggcgccgcactgtatctgtac
cgcggtcccagcgcgccgccccccgccctgcagagacctctggtgccccgcatcctcatc
cacggactccagggcgccagcgagccaccgccgccgctgcccccgctggctggcgtcctc
ccgcgcgccgcgcagcctcggtga

DBGET integrated database retrieval system