KEGG   Equus caballus (horse): 100067921Help
Entry
100067921         CDS       T01058                                 

Gene name
PTGDS
Definition
(RefSeq) prostaglandin-H2 D-isomerase precursor
  KO
K01830  prostaglandin-H2 D-isomerase [EC:5.3.99.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00590  Arachidonic acid metabolism
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100067921 (PTGDS)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     100067921 (PTGDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Triabin
Motif
Other DBs
NCBI-GeneID: 100067921
NCBI-ProteinID: NP_001075337
Ensembl: ENSECAG00000009262
UniProt: O97921
Position
25
AA seq 194 aa AA seqDB search
MAASHTLWMGLVLLGVLGVLQTRAQAQPSLQPNFQQDKFLGRWFTSGLASNSSWFREKKK
VLSMCTSVVAPTADGGFNLTSTFLRKDQCETRTLLLQPAGPPGCYSYTSPHWGMVHEVSV
VETDYEEYALLYTHAESTKGLGGQDFRMATLYSRVQSPRPEVKEKFSTFAKAQGFTEDAI
VFLPQTDKCMEEHN
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttcacacacgctgtggatggggttggtcctgctgggggtcctgggggtcctg
cagacccgagcccaggcccagccctccctgcagcccaacttccaacaggacaagttcctg
ggccgctggttcacctcgggcctggcctccaactcgagctggttccgggagaagaagaag
gtgctgtccatgtgcacgtcggtggtggccccgaccgcagacggcggcttcaacctcacc
tccaccttcctcaggaaagaccagtgtgagacccggaccctgctgctgcagccggccgga
cccccaggctgctatagctacacgagtccccactggggcatggtccatgaggtgtcagtg
gtagagacggactatgaggagtacgctctgctctacacccacgccgagagcaccaaaggc
ctgggcggccaggacttccgcatggccaccctctacagccgtgtgcagagcccgaggcct
gaggtgaaggagaaattcagcaccttcgccaaagcccagggcttcacagaggatgccatt
gtcttcttgccacagaccgataagtgcatggaggagcacaattag

DBGET integrated database retrieval system