KEGG   Equus caballus (horse): 100068006Help
Entry
100068006         CDS       T01058                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2 isoform X1
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04141  Protein processing in endoplasmic reticulum
ecb04210  Apoptosis
ecb04217  Necroptosis
ecb04380  Osteoclast differentiation
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04668  TNF signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb05160  Hepatitis C
ecb05167  Kaposi's sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100068006 (TRAF2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100068006 (TRAF2)
   04064 NF-kappa B signaling pathway
    100068006 (TRAF2)
   04668 TNF signaling pathway
    100068006 (TRAF2)
   04071 Sphingolipid signaling pathway
    100068006 (TRAF2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100068006 (TRAF2)
   04217 Necroptosis
    100068006 (TRAF2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    100068006 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    100068006 (TRAF2)
   04657 IL-17 signaling pathway
    100068006 (TRAF2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    100068006 (TRAF2)
  Development
   04380 Osteoclast differentiation
    100068006 (TRAF2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100068006 (TRAF2)
   05203 Viral carcinogenesis
    100068006 (TRAF2)
   05222 Small cell lung cancer
    100068006 (TRAF2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100068006 (TRAF2)
  Infectious diseases
   05160 Hepatitis C
    100068006 (TRAF2)
   05168 Herpes simplex infection
    100068006 (TRAF2)
   05163 Human cytomegalovirus infection
    100068006 (TRAF2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100068006 (TRAF2)
   05169 Epstein-Barr virus infection
    100068006 (TRAF2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100068006 (TRAF2)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100068006 (TRAF2)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100068006 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-C3HC4_4 Reo_sigmaC MATH DUF1664 Dynamitin SlyX
Motif
Other DBs
NCBI-GeneID: 100068006
NCBI-ProteinID: XP_023485172
Ensembl: ENSECAG00000013192
VGNC: 24455
Position
25
AA seq 516 aa AA seqDB search
MAAASVTPPGSLDLLQPGFSKTLLGTKLEDKYLCSACKNVLRRPFQAQCGHRYCSYCLTS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGHCPFMLTECPACKGLVRLGEKEHHLEHECPERSLSCRHCRAPCCWADMKAHHD
VCPKFPLTCDGCGKKKISREKFQDHVRTCGKCRVPCRFHAVGCPEMVESEKQQEHEAKWL
QEHLAMLLGVLLDTKHLLGDSSSFLGQSQVGNPGAEVSKAAELLQRCEALERKTATFENI
VCVLNREVERVAMTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAMADLEQKVHEM
EASTFDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGT
HVSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVSDMNI
ASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagctagtgtgactcctcctggctccctagatttgctgcagcccggcttctca
aagacccttctggggaccaagctggaggacaagtacctgtgctcggcctgcaagaacgtc
ctgcgcagacccttccaggcacagtgtggccaccgctactgctcctactgcctgaccagc
atcttgagctccgggccccagaactgtgctgcctgcgtgcatgagggcatatatgaagaa
ggcatttcgattttagaaagcagttcggctttcccggacaacgccgcccgcagggaggtg
gagagcctgccggctgtctgtcccagcgacggctgcacctggaaggggacccttaaagag
tacgagagctgccatgaaggacactgcccgttcatgctgaccgagtgccctgcatgtaaa
ggcctggtgcgccttggcgagaaggagcaccacttggagcacgagtgcccggagagaagc
ctcagctgcaggcactgccgggcgccctgctgctgggccgacatgaaggcgcaccatgat
gtctgccccaagttccccttgacttgtgacggctgcggcaagaagaagatctcacgcgag
aagtttcaggaccacgtcagaacgtgtggcaaatgccgagtcccctgcaggttccacgct
gtcggctgccctgagatggtggagagcgagaagcagcaggagcacgaggcaaagtggctc
caggagcacctggccatgctgctgggtgtcctcctggatacaaagcacctcttgggagat
agcagcagtttccttggccagagccaggtggggaacccaggggcggaggtctccaaggct
gcagagctcctgcagaggtgtgaggccttggagaggaagacggctacctttgagaacatt
gtctgcgtcctgaaccgggaggtggagagggtggctatgaccgccgaggcctgtggccgg
cagcaccggctggaccaagacaggatcgaagccctgagtaacaaggtgcagcaattggag
aggagcattggtctgaaggacctggcgatggccgacttggagcagaaggtccacgagatg
gaggcgtccaccttcgatggtgtattcatctggaagatctctgacttcaccaggaagcgc
caggaagccgtggctggccgcacgcccgccatcttctccccagccttctacacgagcagg
tacggctacaagatgtgtctgcgcatctacctgaacggagatggcactgggcgtgggaca
catgtgtctctcttctttgtggtgatgaagggccccaacgacgccctcctgcggtggccc
ttcaaccaaaaggtgaccttaatgctgcttgaccagaacaatcgggagcatgtgatcgat
gccttcaggcccgacgtgacctcctcctctttccagaggcctgtcagtgacatgaacatt
gcaagcggctgccctctcttctgccctgtctctaagatggaggccaagaattcctatgtg
cgcgatgacgccatcttcatcaaggccatcgtggacctgacggggctctag

DBGET integrated database retrieval system