KEGG   Equus caballus (horse): 100068022Help
Entry
100068022         CDS       T01058                                 

Gene name
TESK1
Definition
(RefSeq) dual specificity testis-specific protein kinase 1
  KO
K08841  testis-specific kinase 1 [EC:2.7.12.1]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100068022 (TESK1)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   100068022 (TESK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 100068022
NCBI-ProteinID: XP_023485413
Ensembl: ENSECAG00000000204
VGNC: 24006
Position
25
AA seq 628 aa AA seqDB search
MAGERPPLRGPGPGPGEAPGDGPPGPGGAGGGPGRGRPSSYRALRSAVSSLARVDDFHCA
EKIGAGFFSEVYKVRHRQSGQVMVLKMNRLPSNRGNTLREVQLMNRLRHPNILRFMGVCV
HQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLRLALDIARGLRYLHAKGVFHRDLTSKN
CLIRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADV
FAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRSLVGDDCPLPFLLLAIHCCSMEPST
RAPFTEITQHLEWILEQLPEPAPLPRAPLTHKQGSVPRGGPSATLPRPDPRLSRSRSDLF
LPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKLVAPLPLVPPSPLPSTQLPL
VTTPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSVEERMECEGSSPEPE
PPGPAPQPPLATATDNFISTCSSASRPWSSRSGAPLNNNPPAVVVNSPQAWAGESWNRAQ
HSLPRAAALERTEPSPPPSAPRESDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLN
CEAGSLLCHRGHHAKPPTPSLQLPGARS
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggccggggaacggcccccactgcggggccctgggcccgggccgggagaggcgccgggg
gatgggccccccgggccggggggcgcgggcggaggcccgggccggggccgcccctcctcc
taccgggccctccgcagcgccgtgtccagcctagcgcgcgtggacgatttccactgcgcc
gagaagatcggggccggcttcttctctgaggtctacaaggttcggcaccgacagtccggg
caagtcatggtgctgaaaatgaacaggctccccagtaatcggggaaatacgctacgggag
gtgcagctgatgaaccggctccggcaccccaacatcctaaggttcatgggggtctgtgtg
caccaggggcagctgcacgctcttacagagtacatgaatggggggaccctggaacagctg
ctcagctcccccgaacccctatcctggcctgtcaggctccgcctggctctggacatcgcc
cgtggcctgcggtacctgcatgccaaaggggtattccaccgagacctcacatccaagaac
tgtctgatccgacgggaagaccgaggcttcacagctgttgtgggtgacttcgggctggct
gaaaagattcctgtgtatagggaaggggcgaggaaggagccgctggctgtggtgggttct
ccatactggatggcgccagaggtgttgcggggtgagctatatgatgagaaggctgatgtc
ttcgcttttgggattgttctctgtgagctcatcgctcgagtacctgcggaccctgattac
ctaccccgtactgaggactttggcctggatgtgcctgctttccggagcctagtaggggat
gactgcccactgcctttcctgctcctggccatccattgctgcagtatggaacctagcact
cgtgctcccttcactgaaatcacccagcacctggaatggatcctggagcagctccctgag
ccagcccccctccccagggctcccctgacacacaagcagggctctgttccaagagggggt
ccctctgccacgcttcccaggccagacccccggctctcccgcagccggtccgacctcttc
ctgcccccgtcaccagaatcaccccccaactggggggacaatctgactcgagtcaatccc
ttctcactacgggaagacctcaggggtggcaagatcaagctcctggacacacccagcaag
ctagtcgcacccctgccccttgtaccaccatcaccactgccctccacccagctgcccttg
gtgaccactccagagaccctggtccagcctgggacacctgcccgccgctgccgctcacta
ccgtcatcccctgagctcccccgacgtatggagacagcactgccaggtcctggccctcct
gctgtgggcccctcagttgaagagagaatggagtgtgagggcagcagccctgagccggaa
cccccaggaccagctccccagccgcccctggctacggccacagacaacttcatcagcact
tgttcctcagcctcccggccctggtcctctagatcaggagctccccttaacaacaacccc
ccagctgtggtggtgaactccccacaagcctgggctggggagtcctggaaccgggcccag
catagcctgccccgggcggcagccctggagcggacagaaccctcaccgcccccttcagct
ccccgggaatccgatgaggggctgccgtgcccaggctgctgccttggccccttcagcttt
ggcttcctgtccatgtgcccccgccccacaccagctgttgcccgctaccgcaacctgaac
tgtgaggcgggcagtctcctctgccaccgagggcaccatgccaagccacccacacccagc
ctgcagctgcctggcgcacgctcttag

DBGET integrated database retrieval system